Homologs in group_3

Help

24 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14600 FBDBKF_14600 59.2 Morganella morganii S1 fimC P pilus assembly protein, chaperone PapD
EHELCC_15405 EHELCC_15405 59.2 Morganella morganii S2 fimC P pilus assembly protein, chaperone PapD
NLDBIP_15935 NLDBIP_15935 59.2 Morganella morganii S4 fimC P pilus assembly protein, chaperone PapD
LHKJJB_15905 LHKJJB_15905 59.2 Morganella morganii S3 fimC P pilus assembly protein, chaperone PapD
HKOGLL_15025 HKOGLL_15025 59.2 Morganella morganii S5 fimC P pilus assembly protein, chaperone PapD
F4V73_RS01040 F4V73_RS01040 30.6 Morganella psychrotolerans - fimbria/pilus periplasmic chaperone
F4V73_RS01065 F4V73_RS01065 35.9 Morganella psychrotolerans - molecular chaperone
F4V73_RS01680 F4V73_RS01680 33.8 Morganella psychrotolerans - fimbria/pilus periplasmic chaperone
F4V73_RS01855 F4V73_RS01855 32.1 Morganella psychrotolerans - molecular chaperone
F4V73_RS05995 F4V73_RS05995 18.3 Morganella psychrotolerans - fimbria/pilus periplasmic chaperone
F4V73_RS08430 F4V73_RS08430 27.4 Morganella psychrotolerans - molecular chaperone
F4V73_RS08450 F4V73_RS08450 25.8 Morganella psychrotolerans - molecular chaperone
F4V73_RS08455 F4V73_RS08455 29.4 Morganella psychrotolerans - molecular chaperone
F4V73_RS09380 F4V73_RS09380 26.6 Morganella psychrotolerans - molecular chaperone
F4V73_RS10245 F4V73_RS10245 19.6 Morganella psychrotolerans - molecular chaperone
F4V73_RS10260 F4V73_RS10260 29.4 Morganella psychrotolerans - molecular chaperone
F4V73_RS10275 F4V73_RS10275 27.1 Morganella psychrotolerans - molecular chaperone
F4V73_RS10895 F4V73_RS10895 34.3 Morganella psychrotolerans - molecular chaperone
F4V73_RS12585 F4V73_RS12585 29.4 Morganella psychrotolerans - molecular chaperone
F4V73_RS13305 F4V73_RS13305 23.1 Morganella psychrotolerans - molecular chaperone
F4V73_RS13315 F4V73_RS13315 24.8 Morganella psychrotolerans - molecular chaperone
F4V73_RS13325 F4V73_RS13325 22.4 Morganella psychrotolerans - molecular chaperone
PMI_RS12530 PMI_RS12530 24.2 Proteus mirabilis HI4320 - molecular chaperone
PMI_RS16665 PMI_RS16665 37.8 Proteus mirabilis HI4320 - molecular chaperone

Distribution of the homologs in the orthogroup group_3

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P59590 3.53e-38 135 38 5 177 3 fimC Chaperone protein FimC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P62609 3.67e-38 135 36 5 206 1 focC Chaperone protein FocC Escherichia coli
P62610 3.67e-38 135 36 5 206 3 focC Chaperone protein FocC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P31697 5.31e-38 135 38 5 177 1 fimC Chaperone protein FimC Escherichia coli (strain K12)
P75856 6.99e-33 121 33 5 215 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli (strain K12)
P37923 8.94e-33 121 31 6 222 3 fimC Chaperone protein FimC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P43661 2.68e-32 120 33 6 211 3 lpfB Chaperone protein LpfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X5E4 6.6e-32 119 32 5 215 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli O157:H7
Q8X5K6 3.83e-31 117 33 4 188 2 lpfB Probable fimbrial chaperone LpfB Escherichia coli O157:H7
P21646 2.62e-30 115 32 8 229 3 mrkB Chaperone protein MrkB Klebsiella pneumoniae
P77249 1.66e-29 112 33 4 180 2 sfmC Probable fimbrial chaperone SfmC Escherichia coli (strain K12)
P42914 6.04e-28 108 33 5 181 2 yraI Probable fimbrial chaperone YraI Escherichia coli (strain K12)
P77616 2.4e-26 105 34 10 238 3 yqiH Uncharacterized fimbrial chaperone YqiH Escherichia coli (strain K12)
P25402 8.52e-25 100 34 3 175 3 fanE Chaperone protein FanE Escherichia coli
P15319 1.72e-23 97 32 10 232 1 papD Chaperone protein PapD Escherichia coli
P33128 3.84e-23 96 29 11 232 1 yadV Probable fimbrial chaperone YadV Escherichia coli (strain K12)
P53520 6.61e-23 96 31 7 208 3 pmfD Chaperone protein PmfD Proteus mirabilis (strain HI4320)
P35757 6.86e-23 95 29 10 230 3 hifB Chaperone protein HifB Haemophilus influenzae
P25401 7.75e-23 95 28 5 208 1 faeE Chaperone protein FaeE Escherichia coli
Q05433 2.13e-22 95 28 5 208 3 clpE Chaperone protein ClpE Escherichia coli
P75749 3.7e-22 94 29 6 219 3 ybgP Uncharacterized fimbrial chaperone YbgP Escherichia coli (strain K12)
P77599 8.08e-22 93 30 5 198 2 yfcS Probable fimbrial chaperone YfcS Escherichia coli (strain K12)
P45991 1.4e-21 92 28 9 228 3 hifB Chaperone protein HifB Haemophilus influenzae
P53516 2.12e-20 89 30 6 180 3 afaB Chaperone protein AfaB Escherichia coli
P33409 2.2e-20 89 29 8 219 3 fimB Chaperone protein FimB/FhaD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P40876 4.29e-19 85 26 7 223 2 ycbF Uncharacterized fimbrial chaperone YcbF Escherichia coli (strain K12)
P33342 7.3e-19 85 29 7 223 2 yehC Probable fimbrial chaperone YehC Escherichia coli (strain K12)
P15483 5.06e-18 82 31 5 193 3 None Chaperone protein CS3-1 Escherichia coli
P46004 8.7e-18 82 29 6 207 3 aggD Chaperone protein AggD Escherichia coli
P69966 1.6e-17 82 27 8 222 3 psaB Chaperone protein PsaB Yersinia pseudotuberculosis serotype I (strain IP32953)
P69965 1.6e-17 82 27 8 222 3 psaB Chaperone protein PsaB Yersinia pestis
P33407 1.27e-16 79 28 8 222 3 myfB Chaperone protein MyfB Yersinia enterocolitica
P26926 1.87e-16 79 32 7 179 1 caf1M Chaperone protein caf1M Yersinia pestis
P46738 3.64e-16 77 29 6 180 3 nfaE Chaperone protein NfaE Escherichia coli
P33387 4.19e-12 66 26 6 216 3 sefB Chaperone protein SefB Salmonella enteritidis
P53519 1.25e-11 65 25 5 183 3 cssC Chaperone protein CssC Escherichia coli
P53518 1.79e-11 64 25 4 159 3 cssC Chaperone protein CssC Escherichia coli
P42183 0.000138 43 31 6 108 3 prsD Chaperone protein PrsD (Fragment) Escherichia coli

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07395
Feature type CDS
Gene -
Product molecular chaperone
Location 1544786 - 1545454 (strand: -1)
Length 669 (nucleotides) / 222 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3
Orthogroup size 25
N. genomes 7

Actions

Genomic region

Domains

PF00345 Pili and flagellar-assembly chaperone, PapD N-terminal domain
PF02753 Pili assembly chaperone PapD, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3121 Extracellular structures (W) W P pilus assembly protein, chaperone PapD

Protein Sequence

MKKNIIYFITLWMVCSQAYAGIVVGGTRFIYPQSRKMITVPVENTDSERPYLIQSWIEDEDGINKTKEFVITPVIFQLNEKKKSMFRVLLRKADLKSDRETLFWLNVRGIPATESDTENKLQVVINSKFKLFYRPDGLTEPDFNKIQYEISGRKIKILNKTPYHLTIKSININKKEHSVSDMIKPFDDLIVSANVIYEKNDIVINYISDLGGVISRPVVFNN

Flanking regions ( +/- flanking 50bp)

TACAGGGTGGTAATACGGATTGCTGCCCTGTTATATCAGATAATTTTTTTATGAAAAAAAACATCATTTATTTTATCACGTTATGGATGGTATGCAGCCAGGCATATGCGGGGATTGTGGTCGGGGGAACCCGGTTTATCTATCCTCAGAGCCGGAAAATGATCACTGTGCCGGTTGAAAATACGGATAGTGAACGACCTTACTTAATTCAGTCCTGGATTGAGGATGAAGATGGCATTAATAAAACGAAAGAATTTGTGATAACACCGGTTATATTTCAGTTAAATGAAAAAAAGAAAAGTATGTTTCGTGTTTTATTGCGTAAGGCTGATTTAAAATCAGACAGAGAAACCTTGTTCTGGCTGAACGTACGGGGTATTCCTGCAACAGAATCAGATACTGAAAATAAATTACAGGTTGTTATTAATTCTAAGTTTAAATTGTTTTACCGTCCGGATGGATTAACAGAGCCTGATTTTAATAAAATACAGTATGAGATATCAGGCAGGAAAATAAAAATACTGAATAAAACACCCTATCATCTAACAATAAAGAGCATTAATATAAACAAAAAAGAACATTCTGTTTCCGATATGATTAAGCCCTTTGATGATTTGATTGTTTCAGCTAATGTCATTTATGAGAAAAATGATATTGTTATTAATTATATTAGTGATCTTGGCGGGGTAATCAGCAGGCCGGTGGTTTTCAATAATTAAAAAATAACTGCGGATATATGTATTTAAAAAAAACTCATCTTATATTTATG