Homologs in group_20

Help

14 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09110 FBDBKF_09110 33.8 Morganella morganii S1 fimC P pilus assembly protein, chaperone PapD
FBDBKF_10795 FBDBKF_10795 33.5 Morganella morganii S1 fimC P pilus assembly protein, chaperone PapD
EHELCC_10300 EHELCC_10300 33.8 Morganella morganii S2 fimC P pilus assembly protein, chaperone PapD
EHELCC_15130 EHELCC_15130 33.5 Morganella morganii S2 fimC P pilus assembly protein, chaperone PapD
NLDBIP_10645 NLDBIP_10645 33.8 Morganella morganii S4 fimC P pilus assembly protein, chaperone PapD
NLDBIP_14960 NLDBIP_14960 33.5 Morganella morganii S4 fimC P pilus assembly protein, chaperone PapD
LHKJJB_10710 LHKJJB_10710 33.8 Morganella morganii S3 fimC P pilus assembly protein, chaperone PapD
LHKJJB_14385 LHKJJB_14385 33.5 Morganella morganii S3 fimC P pilus assembly protein, chaperone PapD
HKOGLL_13005 HKOGLL_13005 33.5 Morganella morganii S5 fimC P pilus assembly protein, chaperone PapD
HKOGLL_13770 HKOGLL_13770 33.8 Morganella morganii S5 fimC P pilus assembly protein, chaperone PapD
F4V73_RS01065 F4V73_RS01065 26.4 Morganella psychrotolerans - molecular chaperone
F4V73_RS05995 F4V73_RS05995 21.8 Morganella psychrotolerans - fimbria/pilus periplasmic chaperone
F4V73_RS10840 F4V73_RS10840 34.8 Morganella psychrotolerans - molecular chaperone
F4V73_RS12585 F4V73_RS12585 29.1 Morganella psychrotolerans - molecular chaperone

Distribution of the homologs in the orthogroup group_20

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_20

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P33128 3.6e-41 144 38 11 246 1 yadV Probable fimbrial chaperone YadV Escherichia coli (strain K12)
P35757 4.23e-39 139 37 9 244 3 hifB Chaperone protein HifB Haemophilus influenzae
P33409 4.78e-39 139 35 7 229 3 fimB Chaperone protein FimB/FhaD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P45991 6.56e-39 138 37 9 243 3 hifB Chaperone protein HifB Haemophilus influenzae
P43661 3.84e-35 128 34 8 234 3 lpfB Chaperone protein LpfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P21646 1.57e-31 119 35 12 244 3 mrkB Chaperone protein MrkB Klebsiella pneumoniae
P33342 1.97e-31 119 34 7 233 2 yehC Probable fimbrial chaperone YehC Escherichia coli (strain K12)
P15319 6.76e-31 117 35 11 237 1 papD Chaperone protein PapD Escherichia coli
Q8X5K6 4.95e-29 112 32 7 241 2 lpfB Probable fimbrial chaperone LpfB Escherichia coli O157:H7
P53520 2.64e-26 105 32 9 240 3 pmfD Chaperone protein PmfD Proteus mirabilis (strain HI4320)
P75749 1.42e-25 103 31 8 230 3 ybgP Uncharacterized fimbrial chaperone YbgP Escherichia coli (strain K12)
P42914 8.37e-25 101 29 8 230 2 yraI Probable fimbrial chaperone YraI Escherichia coli (strain K12)
P25401 2.65e-24 100 31 8 232 1 faeE Chaperone protein FaeE Escherichia coli
Q05433 5.58e-23 97 31 9 232 3 clpE Chaperone protein ClpE Escherichia coli
P25402 8.71e-22 93 31 9 238 3 fanE Chaperone protein FanE Escherichia coli
P77249 6.6e-21 91 28 8 242 2 sfmC Probable fimbrial chaperone SfmC Escherichia coli (strain K12)
P37923 2.11e-20 89 30 8 230 3 fimC Chaperone protein FimC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P77616 2.22e-20 90 28 8 235 3 yqiH Uncharacterized fimbrial chaperone YqiH Escherichia coli (strain K12)
P77599 9.54e-20 88 39 6 161 2 yfcS Probable fimbrial chaperone YfcS Escherichia coli (strain K12)
P31697 3.19e-19 87 30 12 243 1 fimC Chaperone protein FimC Escherichia coli (strain K12)
P59590 7.1e-19 85 31 12 243 3 fimC Chaperone protein FimC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P75856 1.81e-18 84 27 7 234 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli (strain K12)
Q8X5E4 1.23e-17 82 27 7 230 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli O157:H7
P62609 3.51e-17 81 28 10 238 1 focC Chaperone protein FocC Escherichia coli
P62610 3.51e-17 81 28 10 238 3 focC Chaperone protein FocC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P69966 4.58e-17 81 28 6 236 3 psaB Chaperone protein PsaB Yersinia pseudotuberculosis serotype I (strain IP32953)
P69965 4.58e-17 81 28 6 236 3 psaB Chaperone protein PsaB Yersinia pestis
P33407 3.12e-13 70 26 9 266 3 myfB Chaperone protein MyfB Yersinia enterocolitica
P53516 1.64e-12 68 28 8 204 3 afaB Chaperone protein AfaB Escherichia coli
P26926 2.62e-12 68 28 9 228 1 caf1M Chaperone protein caf1M Yersinia pestis
P33387 2.74e-11 65 27 7 217 3 sefB Chaperone protein SefB Salmonella enteritidis
P40876 8.4e-10 60 26 10 242 2 ycbF Uncharacterized fimbrial chaperone YcbF Escherichia coli (strain K12)
P46004 1.51e-09 60 25 9 226 3 aggD Chaperone protein AggD Escherichia coli
P53519 3.01e-09 59 28 8 197 3 cssC Chaperone protein CssC Escherichia coli
P53518 4.07e-09 58 28 8 197 3 cssC Chaperone protein CssC Escherichia coli
P46738 5.93e-09 58 27 8 204 3 nfaE Chaperone protein NfaE Escherichia coli
P15483 1.35e-08 57 27 8 191 3 None Chaperone protein CS3-1 Escherichia coli
P42183 1.48e-06 49 32 6 111 3 prsD Chaperone protein PrsD (Fragment) Escherichia coli

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS09380
Feature type CDS
Gene -
Product molecular chaperone
Location 1974980 - 1975747 (strand: -1)
Length 768 (nucleotides) / 255 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_20
Orthogroup size 15
N. genomes 6

Actions

Genomic region

Domains

PF00345 Pili and flagellar-assembly chaperone, PapD N-terminal domain
PF02753 Pili assembly chaperone PapD, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3121 Extracellular structures (W) W P pilus assembly protein, chaperone PapD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07346 fimbrial chaperone protein Two-component system -

Protein Sequence

MFLNLMKSVLLFLLVSSTAMSSVTITGTRIIFIGDNKDQVVRLNNKSMTAPALVQVWVDDGIKINDINNKDIPFVVTPPVSRIEPNKGQSIRLIYNGMVLPQDKESIFYFNLLEIPPENPGAEGPRLDIAFKTRIKLFYRPAALLKSNVIEQADKLVLEQVNNPQKGTGIKVTNPTPYYANFSEMMVNVGGTVVKVNSDTADMVAPGSSVEFYGASALSGTVSEINCSILNDYGSPTDIKLIKGTGPGFTAVKAK

Flanking regions ( +/- flanking 50bp)

GAGCTACATCTGTAGCTCTATATTTTAGTTAACGGAATAACGGATAAATTATGTTTTTAAATTTAATGAAATCGGTTTTACTGTTTCTGCTGGTGAGCAGTACTGCAATGAGTTCGGTTACTATTACAGGAACCCGGATTATATTTATCGGAGACAATAAAGATCAGGTTGTCAGATTAAATAACAAGAGCATGACAGCCCCTGCATTGGTTCAGGTTTGGGTAGATGATGGTATCAAAATTAATGATATCAACAATAAAGATATCCCATTCGTTGTAACGCCGCCGGTCAGTCGTATTGAACCGAATAAAGGCCAAAGTATCCGGTTGATTTATAATGGAATGGTATTGCCACAGGATAAAGAATCGATATTTTATTTTAATCTTCTGGAAATTCCGCCCGAGAATCCCGGCGCTGAAGGTCCCCGTCTGGATATTGCGTTTAAAACACGCATTAAATTATTTTACCGTCCTGCCGCTTTATTAAAATCTAATGTTATTGAGCAGGCAGATAAGCTTGTGTTAGAGCAGGTAAATAATCCTCAAAAAGGAACCGGAATTAAAGTAACGAATCCGACTCCTTATTACGCCAATTTTTCAGAAATGATGGTGAATGTCGGGGGAACAGTCGTTAAAGTAAATTCAGATACAGCTGATATGGTAGCACCCGGTTCATCAGTAGAGTTTTATGGCGCTTCAGCGCTATCCGGCACAGTTTCTGAAATTAATTGCAGCATTCTTAATGACTATGGCTCACCAACTGATATCAAATTAATTAAAGGTACCGGACCCGGGTTCACCGCTGTAAAAGCAAAATAAATGGATTTATTTCGCAGTTATTCATGGATTGTGACTGCGTACAGAGGGGT