Homologs in group_395

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_15405 EHELCC_15405 100.0 Morganella morganii S2 fimC P pilus assembly protein, chaperone PapD
NLDBIP_15935 NLDBIP_15935 100.0 Morganella morganii S4 fimC P pilus assembly protein, chaperone PapD
LHKJJB_15905 LHKJJB_15905 100.0 Morganella morganii S3 fimC P pilus assembly protein, chaperone PapD
HKOGLL_15025 HKOGLL_15025 100.0 Morganella morganii S5 fimC P pilus assembly protein, chaperone PapD
F4V73_RS07395 F4V73_RS07395 59.2 Morganella psychrotolerans - molecular chaperone
PMI_RS16665 PMI_RS16665 37.2 Proteus mirabilis HI4320 - molecular chaperone

Distribution of the homologs in the orthogroup group_395

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_395

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P59590 4.15e-44 150 38 7 226 3 fimC Chaperone protein FimC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P31697 2.86e-43 148 38 8 226 1 fimC Chaperone protein FimC Escherichia coli (strain K12)
P62609 1.25e-41 144 34 5 223 1 focC Chaperone protein FocC Escherichia coli
P62610 1.25e-41 144 34 5 223 3 focC Chaperone protein FocC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X5K6 1.78e-41 144 39 5 220 2 lpfB Probable fimbrial chaperone LpfB Escherichia coli O157:H7
P37923 9.77e-41 142 34 5 222 3 fimC Chaperone protein FimC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P77249 5.17e-35 127 33 7 219 2 sfmC Probable fimbrial chaperone SfmC Escherichia coli (strain K12)
P43661 1.98e-32 120 34 7 218 3 lpfB Chaperone protein LpfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X5E4 2.27e-30 115 31 4 215 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli O157:H7
P42914 6.15e-30 114 30 7 219 2 yraI Probable fimbrial chaperone YraI Escherichia coli (strain K12)
P75856 9.07e-30 113 30 4 215 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli (strain K12)
P21646 5.48e-29 111 31 7 223 3 mrkB Chaperone protein MrkB Klebsiella pneumoniae
P53516 1.08e-26 105 35 6 191 3 afaB Chaperone protein AfaB Escherichia coli
P53520 3.65e-26 104 30 9 226 3 pmfD Chaperone protein PmfD Proteus mirabilis (strain HI4320)
P35757 7.31e-26 103 28 6 222 3 hifB Chaperone protein HifB Haemophilus influenzae
P45991 8.21e-26 103 28 6 222 3 hifB Chaperone protein HifB Haemophilus influenzae
P33342 1.7e-25 102 30 6 220 2 yehC Probable fimbrial chaperone YehC Escherichia coli (strain K12)
P46004 5.35e-25 101 31 6 207 3 aggD Chaperone protein AggD Escherichia coli
P46738 5.74e-23 96 33 6 191 3 nfaE Chaperone protein NfaE Escherichia coli
P15319 1.17e-22 95 30 8 225 1 papD Chaperone protein PapD Escherichia coli
P40876 4.29e-22 93 29 8 228 2 ycbF Uncharacterized fimbrial chaperone YcbF Escherichia coli (strain K12)
P77616 2.78e-21 91 29 9 228 3 yqiH Uncharacterized fimbrial chaperone YqiH Escherichia coli (strain K12)
P33409 9.42e-21 90 28 10 233 3 fimB Chaperone protein FimB/FhaD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P77599 9.48e-21 90 29 6 198 2 yfcS Probable fimbrial chaperone YfcS Escherichia coli (strain K12)
P33407 1.49e-20 90 30 9 222 3 myfB Chaperone protein MyfB Yersinia enterocolitica
P25402 6.26e-20 87 24 4 214 3 fanE Chaperone protein FanE Escherichia coli
P25401 1.02e-19 87 28 2 172 1 faeE Chaperone protein FaeE Escherichia coli
P69966 1.18e-19 87 29 8 222 3 psaB Chaperone protein PsaB Yersinia pseudotuberculosis serotype I (strain IP32953)
P69965 1.18e-19 87 29 8 222 3 psaB Chaperone protein PsaB Yersinia pestis
P75749 1.37e-19 87 26 6 216 3 ybgP Uncharacterized fimbrial chaperone YbgP Escherichia coli (strain K12)
Q05433 2.78e-19 86 27 2 172 3 clpE Chaperone protein ClpE Escherichia coli
P33128 4.83e-19 85 26 11 233 1 yadV Probable fimbrial chaperone YadV Escherichia coli (strain K12)
P26926 1.22e-16 79 32 5 176 1 caf1M Chaperone protein caf1M Yersinia pestis
P33387 2.41e-16 78 30 7 213 3 sefB Chaperone protein SefB Salmonella enteritidis
P15483 2.93e-15 75 30 7 204 3 None Chaperone protein CS3-1 Escherichia coli
P53518 1.94e-13 70 25 4 184 3 cssC Chaperone protein CssC Escherichia coli
P53519 4.22e-13 69 27 5 180 3 cssC Chaperone protein CssC Escherichia coli

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_14600
Feature type CDS
Gene fimC
Product P pilus assembly protein, chaperone PapD
Location 16558 - 17229 (strand: -1)
Length 672 (nucleotides) / 223 (amino acids)
In genomic island -

Contig

Accession contig_19
Length 86773 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_395
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00345 Pili and flagellar-assembly chaperone, PapD N-terminal domain
PF02753 Pili assembly chaperone PapD, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3121 Extracellular structures (W) W P pilus assembly protein, chaperone PapD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07346 fimbrial chaperone protein Two-component system -

Protein Sequence

MKIGFTFLIIIFFLTMSRATAGVVVGGTRFIYPQDKKMITIPVDNTDKKSAYLIQSWVEKEDGMTKSKDFILTPVIFQLDAGKKGILRVMLKKTEFPDDRESLLWLNIKGIPETDENRENKLQIVINSKFKLFYRPAGLTEPDYNKLRYERKGNRIKIINDLPFHITVRNILVNNKEYTVSEMIVPFESLTVPVTTIHSNDKITISYISDFGGIISKPVVFDK

Flanking regions ( +/- flanking 50bp)

ACATTTAATACCGGCGGCAACAGGTGTTGCCGCCCCGGATAAACAGCACCATGAAAATCGGTTTCACTTTCCTTATTATTATTTTTTTTCTGACCATGAGCCGGGCAACTGCCGGGGTGGTTGTTGGCGGCACCCGGTTTATTTATCCGCAGGATAAAAAAATGATCACAATTCCTGTTGATAATACGGATAAAAAATCAGCCTATTTAATTCAGAGCTGGGTTGAAAAAGAAGATGGCATGACGAAAAGTAAGGACTTTATTCTCACGCCGGTTATTTTTCAGCTGGATGCAGGAAAAAAAGGAATTTTGCGTGTCATGCTGAAAAAAACAGAATTTCCGGATGACAGAGAATCATTACTCTGGCTGAATATAAAAGGAATTCCGGAAACAGATGAAAACAGAGAAAATAAACTTCAGATTGTTATTAATTCAAAGTTTAAATTATTCTATCGCCCTGCAGGATTAACTGAGCCTGATTATAATAAACTGAGGTATGAGCGAAAAGGAAACAGAATAAAAATCATTAATGACTTACCTTTTCATATCACCGTCAGAAATATTTTGGTTAATAATAAGGAATATACTGTTTCGGAGATGATAGTTCCCTTCGAATCATTAACTGTACCGGTAACAACTATTCATAGTAATGACAAAATAACCATAAGCTACATCTCCGATTTTGGCGGGATTATTTCGAAACCTGTTGTTTTTGATAAATAATATTATTATGCAATTGAAAGCACCTTATTTTTTTCTTCTGGCAGTGGTGA