Homologs in group_3

Help

24 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14600 FBDBKF_14600 37.2 Morganella morganii S1 fimC P pilus assembly protein, chaperone PapD
EHELCC_15405 EHELCC_15405 37.2 Morganella morganii S2 fimC P pilus assembly protein, chaperone PapD
NLDBIP_15935 NLDBIP_15935 37.2 Morganella morganii S4 fimC P pilus assembly protein, chaperone PapD
LHKJJB_15905 LHKJJB_15905 37.2 Morganella morganii S3 fimC P pilus assembly protein, chaperone PapD
HKOGLL_15025 HKOGLL_15025 37.2 Morganella morganii S5 fimC P pilus assembly protein, chaperone PapD
F4V73_RS01040 F4V73_RS01040 36.6 Morganella psychrotolerans - fimbria/pilus periplasmic chaperone
F4V73_RS01065 F4V73_RS01065 30.4 Morganella psychrotolerans - molecular chaperone
F4V73_RS01680 F4V73_RS01680 35.4 Morganella psychrotolerans - fimbria/pilus periplasmic chaperone
F4V73_RS01855 F4V73_RS01855 32.5 Morganella psychrotolerans - molecular chaperone
F4V73_RS05995 F4V73_RS05995 18.8 Morganella psychrotolerans - fimbria/pilus periplasmic chaperone
F4V73_RS07395 F4V73_RS07395 37.8 Morganella psychrotolerans - molecular chaperone
F4V73_RS08430 F4V73_RS08430 26.3 Morganella psychrotolerans - molecular chaperone
F4V73_RS08450 F4V73_RS08450 27.1 Morganella psychrotolerans - molecular chaperone
F4V73_RS08455 F4V73_RS08455 26.7 Morganella psychrotolerans - molecular chaperone
F4V73_RS09380 F4V73_RS09380 27.8 Morganella psychrotolerans - molecular chaperone
F4V73_RS10245 F4V73_RS10245 24.3 Morganella psychrotolerans - molecular chaperone
F4V73_RS10260 F4V73_RS10260 30.0 Morganella psychrotolerans - molecular chaperone
F4V73_RS10275 F4V73_RS10275 19.7 Morganella psychrotolerans - molecular chaperone
F4V73_RS10895 F4V73_RS10895 32.7 Morganella psychrotolerans - molecular chaperone
F4V73_RS12585 F4V73_RS12585 32.1 Morganella psychrotolerans - molecular chaperone
F4V73_RS13305 F4V73_RS13305 24.9 Morganella psychrotolerans - molecular chaperone
F4V73_RS13315 F4V73_RS13315 25.7 Morganella psychrotolerans - molecular chaperone
F4V73_RS13325 F4V73_RS13325 23.4 Morganella psychrotolerans - molecular chaperone
PMI_RS12530 PMI_RS12530 29.0 Proteus mirabilis HI4320 - molecular chaperone

Distribution of the homologs in the orthogroup group_3

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37923 3.42e-39 137 36 3 212 3 fimC Chaperone protein FimC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P77249 2.64e-37 132 33 4 221 2 sfmC Probable fimbrial chaperone SfmC Escherichia coli (strain K12)
P62609 6.11e-34 124 33 7 218 1 focC Chaperone protein FocC Escherichia coli
P62610 6.11e-34 124 33 7 218 3 focC Chaperone protein FocC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P59590 9.34e-33 121 33 5 216 3 fimC Chaperone protein FimC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P31697 4.58e-32 119 33 5 216 1 fimC Chaperone protein FimC Escherichia coli (strain K12)
P21646 1.69e-30 115 34 7 228 3 mrkB Chaperone protein MrkB Klebsiella pneumoniae
P75856 9.89e-30 113 33 6 215 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli (strain K12)
Q8X5E4 1.25e-29 113 33 6 215 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli O157:H7
P42914 1.34e-28 110 31 4 220 2 yraI Probable fimbrial chaperone YraI Escherichia coli (strain K12)
Q8X5K6 3.23e-28 109 29 5 221 2 lpfB Probable fimbrial chaperone LpfB Escherichia coli O157:H7
P43661 1.25e-25 102 35 1 143 3 lpfB Chaperone protein LpfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P53520 1.65e-23 97 32 8 220 3 pmfD Chaperone protein PmfD Proteus mirabilis (strain HI4320)
P15319 1.83e-22 94 30 10 225 1 papD Chaperone protein PapD Escherichia coli
P35757 2.25e-21 91 29 9 231 3 hifB Chaperone protein HifB Haemophilus influenzae
P77599 3.81e-21 91 29 8 199 2 yfcS Probable fimbrial chaperone YfcS Escherichia coli (strain K12)
P33409 1.23e-20 89 32 7 185 3 fimB Chaperone protein FimB/FhaD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P45991 1e-19 87 28 7 228 3 hifB Chaperone protein HifB Haemophilus influenzae
P33342 2.31e-19 86 30 6 178 2 yehC Probable fimbrial chaperone YehC Escherichia coli (strain K12)
P33387 2.93e-19 86 28 5 205 3 sefB Chaperone protein SefB Salmonella enteritidis
P33128 5.45e-19 85 27 10 237 1 yadV Probable fimbrial chaperone YadV Escherichia coli (strain K12)
P53519 5.86e-19 85 29 5 221 3 cssC Chaperone protein CssC Escherichia coli
Q05433 1.86e-18 84 26 6 215 3 clpE Chaperone protein ClpE Escherichia coli
P25401 1.89e-18 84 26 6 215 1 faeE Chaperone protein FaeE Escherichia coli
P53518 9.63e-18 81 28 5 221 3 cssC Chaperone protein CssC Escherichia coli
P77616 3.2e-17 80 27 8 214 3 yqiH Uncharacterized fimbrial chaperone YqiH Escherichia coli (strain K12)
P75749 4.05e-17 80 28 7 225 3 ybgP Uncharacterized fimbrial chaperone YbgP Escherichia coli (strain K12)
P25402 6.07e-17 79 26 6 222 3 fanE Chaperone protein FanE Escherichia coli
P33407 1.61e-16 79 25 9 247 3 myfB Chaperone protein MyfB Yersinia enterocolitica
P40876 1.9e-16 78 30 9 226 2 ycbF Uncharacterized fimbrial chaperone YcbF Escherichia coli (strain K12)
P53516 2.26e-16 78 28 6 207 3 afaB Chaperone protein AfaB Escherichia coli
P26926 9.7e-16 77 26 8 219 1 caf1M Chaperone protein caf1M Yersinia pestis
P69966 1.67e-15 76 25 7 220 3 psaB Chaperone protein PsaB Yersinia pseudotuberculosis serotype I (strain IP32953)
P69965 1.67e-15 76 25 7 220 3 psaB Chaperone protein PsaB Yersinia pestis
P46738 3.86e-14 72 28 6 207 3 nfaE Chaperone protein NfaE Escherichia coli
P46004 4.65e-14 72 27 5 207 3 aggD Chaperone protein AggD Escherichia coli
P15483 6.79e-11 63 26 6 208 3 None Chaperone protein CS3-1 Escherichia coli

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16665
Feature type CDS
Gene -
Product molecular chaperone
Location 3674542 - 3675201 (strand: -1)
Length 660 (nucleotides) / 219 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3
Orthogroup size 25
N. genomes 7

Actions

Genomic region

Domains

PF00345 Pili and flagellar-assembly chaperone, PapD N-terminal domain
PF02753 Pili assembly chaperone PapD, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3121 Extracellular structures (W) W P pilus assembly protein, chaperone PapD

Protein Sequence

MKKNISLILFLLFSLITASQAAGISVGGTRFVYDDNLREISIPIMNTDKEKPYLIQSWVSAYQGDEKTPFIATPPLFRIEPDSSGTARISYTGAPLASNQEVVYWLNIKSIPPMEKSPENQLQLVINSQFKLFLRAHDIEPLDFDKVKLSKQNKGLVINNDTPYHLTIKHILVGDKRYPFNDFVNPHQEVVLLKENHIPQKVTVQFINDYGATVDKVLN

Flanking regions ( +/- flanking 50bp)

GAGGGTAATCACCATTACCCTCTCACCTCTCCTCAAACTTATGGCCACTTATGAAAAAGAATATTTCCCTAATATTATTTTTACTATTTTCCCTCATAACGGCTAGCCAAGCTGCTGGAATAAGTGTGGGAGGAACACGTTTTGTCTATGACGATAATCTACGTGAAATCAGTATTCCAATTATGAATACAGATAAGGAAAAACCCTATTTAATTCAAAGTTGGGTTTCAGCTTATCAAGGTGATGAAAAAACACCTTTTATTGCAACACCTCCACTATTTCGTATTGAGCCAGATAGTTCAGGCACGGCGCGAATTTCATATACCGGAGCACCTTTGGCATCAAACCAAGAAGTGGTTTATTGGCTCAATATCAAATCCATTCCACCGATGGAAAAAAGTCCAGAGAATCAACTCCAATTAGTGATTAACTCTCAATTTAAATTGTTTCTCCGTGCCCATGATATTGAACCACTTGATTTTGATAAGGTGAAATTATCTAAACAAAATAAAGGGTTAGTAATAAATAACGATACGCCGTATCACCTGACAATTAAACATATCTTAGTGGGTGATAAACGCTACCCATTTAATGATTTTGTTAATCCTCACCAAGAAGTGGTCTTGCTAAAAGAAAATCATATTCCGCAGAAAGTTACCGTTCAATTTATCAATGATTACGGTGCGACTGTAGATAAAGTATTAAATTAAGAGTATACGGCGATGACTTTTTCTATGATAGCAGTATCTACAAAACGATT