Homologs in group_3650

Help

3 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS05730 PMI_RS05730 28.2 Proteus mirabilis HI4320 - molecular chaperone
PMI_RS05770 PMI_RS05770 33.5 Proteus mirabilis HI4320 - molecular chaperone
PMI_RS15275 PMI_RS15275 20.5 Proteus mirabilis HI4320 - fimbria/pilus chaperone family protein

Distribution of the homologs in the orthogroup group_3650

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3650

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P31697 1.23e-18 84 26 8 221 1 fimC Chaperone protein FimC Escherichia coli (strain K12)
Q8X5E4 1.51e-18 84 29 10 235 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli O157:H7
P59590 3.74e-18 83 26 8 221 3 fimC Chaperone protein FimC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P75856 4.81e-18 83 29 10 235 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli (strain K12)
P37923 1.7e-17 81 30 12 232 3 fimC Chaperone protein FimC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P42914 5.32e-17 80 27 10 232 2 yraI Probable fimbrial chaperone YraI Escherichia coli (strain K12)
P62609 1.65e-15 76 26 8 234 1 focC Chaperone protein FocC Escherichia coli
P62610 1.65e-15 76 26 8 234 3 focC Chaperone protein FocC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P35757 1.04e-14 74 27 12 242 3 hifB Chaperone protein HifB Haemophilus influenzae
P45991 1.41e-14 73 26 12 241 3 hifB Chaperone protein HifB Haemophilus influenzae
P53518 1.64e-14 73 29 8 231 3 cssC Chaperone protein CssC Escherichia coli
P43661 4.73e-14 72 25 7 219 3 lpfB Chaperone protein LpfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P75749 6.62e-14 72 27 11 221 3 ybgP Uncharacterized fimbrial chaperone YbgP Escherichia coli (strain K12)
P53519 7.38e-14 71 30 9 236 3 cssC Chaperone protein CssC Escherichia coli
Q8X5K6 2.65e-13 70 27 7 208 2 lpfB Probable fimbrial chaperone LpfB Escherichia coli O157:H7
P40876 4.76e-12 66 29 10 230 2 ycbF Uncharacterized fimbrial chaperone YcbF Escherichia coli (strain K12)
P21646 7.25e-12 66 26 8 223 3 mrkB Chaperone protein MrkB Klebsiella pneumoniae
P15483 1.47e-11 65 28 10 236 3 None Chaperone protein CS3-1 Escherichia coli
P77249 2.33e-11 64 27 11 222 2 sfmC Probable fimbrial chaperone SfmC Escherichia coli (strain K12)
P53520 3.41e-11 64 25 11 232 3 pmfD Chaperone protein PmfD Proteus mirabilis (strain HI4320)
P33409 1.63e-10 62 23 8 217 3 fimB Chaperone protein FimB/FhaD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P46004 2.24e-10 62 24 11 255 3 aggD Chaperone protein AggD Escherichia coli
P25401 2.53e-10 62 22 6 228 1 faeE Chaperone protein FaeE Escherichia coli
P33128 4.02e-10 61 27 14 253 1 yadV Probable fimbrial chaperone YadV Escherichia coli (strain K12)
Q05433 5.7e-10 61 23 7 229 3 clpE Chaperone protein ClpE Escherichia coli
P33342 2.22e-07 53 24 7 202 2 yehC Probable fimbrial chaperone YehC Escherichia coli (strain K12)
P77616 1.36e-06 51 25 13 235 3 yqiH Uncharacterized fimbrial chaperone YqiH Escherichia coli (strain K12)
P26926 8.89e-06 48 23 11 217 1 caf1M Chaperone protein caf1M Yersinia pestis
P25402 0.000168 45 24 8 217 3 fanE Chaperone protein FanE Escherichia coli
P33407 0.000415 44 21 13 280 3 myfB Chaperone protein MyfB Yersinia enterocolitica

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS13315
Feature type CDS
Gene -
Product molecular chaperone
Location 291423 - 292133 (strand: 1)
Length 711 (nucleotides) / 236 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000003
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3650
Orthogroup size 4
N. genomes 2

Actions

Genomic region

Domains

PF00345 Pili and flagellar-assembly chaperone, PapD N-terminal domain
PF02753 Pili assembly chaperone PapD, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3121 Extracellular structures (W) W P pilus assembly protein, chaperone PapD

Protein Sequence

MKKHIFNNIIFTTLFLFAFNCHAQNNTNGIILNKTRVIIVNDTDSLSIKNNSDNIYLIKSDILTGPEINDKKNDSIIISPPLLKIKGNETKTIKLWKKKHHVSDREDIAYLSVLAIPSTPESHINNDYISVGLRSVIKVFIRPASLPELTHHSVCNLNFEKTTNKQVTTTNTTAYFITISEVIVNDNENILDRPVMIYPFDNVKINIAPEIQKIKWRYINDYGTSSEYCDARIKHN

Flanking regions ( +/- flanking 50bp)

AACCGGGTGAAATGAAAGCCATTGTTTATTTTGATTTCAGATATGACTAAATGAAAAAACATATATTTAATAACATTATTTTTACAACATTATTCCTATTCGCATTTAATTGTCATGCACAAAACAACACAAACGGGATAATACTTAATAAAACAAGAGTCATTATCGTCAATGATACTGATAGCTTATCAATAAAGAATAATAGCGATAATATATATCTTATAAAAAGCGATATATTGACAGGGCCTGAAATTAACGACAAAAAAAATGATAGCATCATCATTTCGCCTCCGTTACTAAAAATAAAGGGAAATGAAACAAAGACCATAAAACTATGGAAAAAGAAACATCATGTATCAGATCGTGAAGATATTGCCTATCTCTCTGTTCTTGCGATCCCGTCAACGCCTGAAAGTCATATTAATAATGATTATATTTCAGTTGGATTAAGAAGTGTTATTAAAGTATTTATAAGACCCGCGTCATTACCTGAACTCACTCATCATTCAGTATGCAACCTGAACTTTGAGAAAACAACGAATAAACAGGTTACCACAACCAACACGACCGCTTATTTCATCACCATAAGTGAAGTAATAGTTAATGATAACGAAAACATATTAGACAGACCCGTAATGATTTACCCTTTTGACAATGTCAAAATAAATATAGCTCCGGAAATACAAAAAATAAAATGGAGATATATCAATGACTATGGAACCTCCTCTGAGTACTGCGATGCCCGGATAAAACACAATTAATAAAAGATATTATTTTTAACACAAGGGAATACTTAAAAATGAAAAAATAT