Homologs in group_23

Help

18 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20020 FBDBKF_20020 44.3 Morganella morganii S1 - Molecular chaperone
FBDBKF_20060 FBDBKF_20060 42.2 Morganella morganii S1 - Fimbria/pilus periplasmic chaperone
EHELCC_03470 EHELCC_03470 42.2 Morganella morganii S2 - Fimbria/pilus periplasmic chaperone
EHELCC_03510 EHELCC_03510 44.3 Morganella morganii S2 - Molecular chaperone
NLDBIP_03470 NLDBIP_03470 42.2 Morganella morganii S4 - Fimbria/pilus periplasmic chaperone
NLDBIP_03510 NLDBIP_03510 44.3 Morganella morganii S4 - Molecular chaperone
LHKJJB_09300 LHKJJB_09300 42.2 Morganella morganii S3 - Fimbria/pilus periplasmic chaperone
LHKJJB_09340 LHKJJB_09340 44.3 Morganella morganii S3 - Molecular chaperone
HKOGLL_09635 HKOGLL_09635 44.3 Morganella morganii S5 - Molecular chaperone
HKOGLL_09675 HKOGLL_09675 42.2 Morganella morganii S5 - Fimbria/pilus periplasmic chaperone
PMI_RS05730 PMI_RS05730 24.9 Proteus mirabilis HI4320 - molecular chaperone
PMI_RS05770 PMI_RS05770 30.8 Proteus mirabilis HI4320 - molecular chaperone
PMI_RS07100 PMI_RS07100 39.6 Proteus mirabilis HI4320 - fimbria/pilus periplasmic chaperone
PMI_RS10905 PMI_RS10905 44.0 Proteus mirabilis HI4320 - molecular chaperone
PMI_RS12535 PMI_RS12535 29.3 Proteus mirabilis HI4320 - molecular chaperone
PMI_RS12550 PMI_RS12550 29.9 Proteus mirabilis HI4320 - molecular chaperone
PMI_RS13450 PMI_RS13450 43.2 Proteus mirabilis HI4320 - fimbria/pilus periplasmic chaperone
PMI_RS15275 PMI_RS15275 21.5 Proteus mirabilis HI4320 - fimbria/pilus chaperone family protein

Distribution of the homologs in the orthogroup group_23

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_23

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P59590 3.33e-91 271 56 1 214 3 fimC Chaperone protein FimC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P31697 5.41e-90 268 56 1 214 1 fimC Chaperone protein FimC Escherichia coli (strain K12)
P62609 1.54e-87 261 58 2 218 1 focC Chaperone protein FocC Escherichia coli
P62610 1.54e-87 261 58 2 218 3 focC Chaperone protein FocC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P37923 1.58e-68 213 47 5 225 3 fimC Chaperone protein FimC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P77249 2.5e-64 202 46 4 223 2 sfmC Probable fimbrial chaperone SfmC Escherichia coli (strain K12)
P75856 9.14e-49 162 40 6 232 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli (strain K12)
Q8X5E4 1.69e-48 162 40 5 230 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli O157:H7
P42914 3.22e-44 151 37 4 215 2 yraI Probable fimbrial chaperone YraI Escherichia coli (strain K12)
P43661 5.16e-41 142 37 6 212 3 lpfB Chaperone protein LpfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X5K6 6.9e-41 142 35 7 230 2 lpfB Probable fimbrial chaperone LpfB Escherichia coli O157:H7
P21646 2.86e-34 125 36 9 230 3 mrkB Chaperone protein MrkB Klebsiella pneumoniae
P35757 1.43e-33 124 35 6 228 3 hifB Chaperone protein HifB Haemophilus influenzae
P33409 1.75e-33 124 33 6 223 3 fimB Chaperone protein FimB/FhaD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P45991 1.01e-32 121 35 6 228 3 hifB Chaperone protein HifB Haemophilus influenzae
P53520 9.67e-32 119 35 9 233 3 pmfD Chaperone protein PmfD Proteus mirabilis (strain HI4320)
P75749 2.26e-30 115 32 7 232 3 ybgP Uncharacterized fimbrial chaperone YbgP Escherichia coli (strain K12)
P53516 2.36e-30 115 33 3 198 3 afaB Chaperone protein AfaB Escherichia coli
P26926 5.67e-30 115 32 4 214 1 caf1M Chaperone protein caf1M Yersinia pestis
P46004 1.36e-29 114 32 4 209 3 aggD Chaperone protein AggD Escherichia coli
P33128 2.65e-29 113 30 8 231 1 yadV Probable fimbrial chaperone YadV Escherichia coli (strain K12)
P40876 3.11e-29 112 30 5 230 2 ycbF Uncharacterized fimbrial chaperone YcbF Escherichia coli (strain K12)
P25402 1.58e-28 110 31 8 226 3 fanE Chaperone protein FanE Escherichia coli
P15319 5.14e-28 109 32 9 225 1 papD Chaperone protein PapD Escherichia coli
P46738 4.76e-26 104 30 3 211 3 nfaE Chaperone protein NfaE Escherichia coli
P33342 5.91e-26 103 27 3 215 2 yehC Probable fimbrial chaperone YehC Escherichia coli (strain K12)
P69966 7.02e-24 99 28 5 223 3 psaB Chaperone protein PsaB Yersinia pseudotuberculosis serotype I (strain IP32953)
P69965 7.02e-24 99 28 5 223 3 psaB Chaperone protein PsaB Yersinia pestis
P15483 2.58e-23 97 33 9 231 3 None Chaperone protein CS3-1 Escherichia coli
P33407 9.22e-23 96 28 6 223 3 myfB Chaperone protein MyfB Yersinia enterocolitica
P77616 2.15e-21 92 29 9 223 3 yqiH Uncharacterized fimbrial chaperone YqiH Escherichia coli (strain K12)
P33387 3.72e-21 91 27 5 210 3 sefB Chaperone protein SefB Salmonella enteritidis
P25401 1.78e-20 90 32 9 197 1 faeE Chaperone protein FaeE Escherichia coli
Q05433 2.54e-20 89 32 9 197 3 clpE Chaperone protein ClpE Escherichia coli
P53519 7.87e-20 87 30 8 233 3 cssC Chaperone protein CssC Escherichia coli
P53518 4.27e-19 85 30 6 228 3 cssC Chaperone protein CssC Escherichia coli
P77599 9.74e-19 85 29 8 240 2 yfcS Probable fimbrial chaperone YfcS Escherichia coli (strain K12)
P42183 3.24e-07 50 31 4 101 3 prsD Chaperone protein PrsD (Fragment) Escherichia coli

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17125
Feature type CDS
Gene -
Product fimbria/pilus periplasmic chaperone
Location 3767057 - 3767755 (strand: 1)
Length 699 (nucleotides) / 232 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_23
Orthogroup size 19
N. genomes 6

Actions

Genomic region

Domains

PF00345 Pili and flagellar-assembly chaperone, PapD N-terminal domain
PF02753 Pili assembly chaperone PapD, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3121 Extracellular structures (W) W P pilus assembly protein, chaperone PapD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07346 fimbrial chaperone protein Two-component system -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG042714 fimbria/pilus periplasmic chaperone VF1153 Adherence

Protein Sequence

MNSILTFSKIKLLFLMLLTLCVINQAYAAVSLGATRVIYFAGEKQVKLPVINNDEKRYLIQSWIENSEGKKDNSFVITPPLFSMQGKKENTLRIIDATNNKLPKDRETLFWLSVKSIPAVEKSLANENMLQLAIISKIKFFYRPKDLTISPDENYKKLQFKRNNDTLIIKNPTPYFITMTELELGGKKLENTMVPPFEDKSISIPTSAYGKLSFQTINDYGAITPKTIVDVR

Flanking regions ( +/- flanking 50bp)

GGTTATTTTAATAAGACATACACCAAGATTAGCTATAGTGGATTATAAAAATGAATAGTATTCTAACTTTTTCTAAAATAAAGCTTCTTTTTTTAATGCTCTTAACTCTATGTGTCATTAACCAAGCATATGCTGCTGTATCATTAGGGGCAACTAGAGTCATTTATTTTGCAGGTGAAAAGCAAGTAAAATTACCAGTAATTAATAATGATGAAAAACGTTATTTAATACAGTCTTGGATAGAAAATAGCGAAGGAAAGAAAGATAACTCTTTTGTTATTACGCCTCCTCTATTTTCTATGCAGGGTAAAAAAGAGAATACTTTAAGAATTATAGATGCAACTAACAATAAATTACCGAAAGATAGAGAAACTTTATTTTGGTTGAGTGTAAAATCTATCCCCGCTGTAGAAAAATCACTTGCTAATGAGAATATGTTACAACTTGCGATTATTAGTAAAATAAAATTCTTTTATAGACCAAAAGATCTCACCATATCTCCAGATGAAAATTATAAAAAACTACAATTTAAACGTAATAATGACACACTTATTATAAAAAATCCGACACCTTATTTTATTACGATGACTGAATTAGAACTTGGTGGTAAAAAATTAGAGAACACTATGGTTCCACCTTTTGAAGATAAGTCTATCTCTATTCCAACATCAGCTTATGGGAAACTCTCGTTTCAAACTATTAATGATTATGGTGCCATCACACCAAAAACAATCGTCGACGTTAGATAATCATTATTTAATATTGTAGAATTGAAAGAGTGATATTATGTCATTTTCAA