Homologs in group_3650

Help

3 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS13315 F4V73_RS13315 28.2 Morganella psychrotolerans - molecular chaperone
PMI_RS05770 PMI_RS05770 33.0 Proteus mirabilis HI4320 - molecular chaperone
PMI_RS15275 PMI_RS15275 16.8 Proteus mirabilis HI4320 - fimbria/pilus chaperone family protein

Distribution of the homologs in the orthogroup group_3650

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3650

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P42914 4.48e-22 93 27 6 222 2 yraI Probable fimbrial chaperone YraI Escherichia coli (strain K12)
P43661 5.7e-22 93 28 3 190 3 lpfB Chaperone protein LpfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P62609 9.3e-21 90 26 3 178 1 focC Chaperone protein FocC Escherichia coli
P62610 9.3e-21 90 26 3 178 3 focC Chaperone protein FocC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X5K6 3.43e-20 88 31 4 175 2 lpfB Probable fimbrial chaperone LpfB Escherichia coli O157:H7
P75856 2.97e-19 86 27 8 228 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli (strain K12)
Q8X5E4 5.14e-19 85 26 8 228 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli O157:H7
P15319 1.54e-17 81 26 6 209 1 papD Chaperone protein PapD Escherichia coli
P59590 3.92e-17 80 26 3 171 3 fimC Chaperone protein FimC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P31697 8.93e-16 77 26 3 171 1 fimC Chaperone protein FimC Escherichia coli (strain K12)
P75749 9.64e-16 77 22 5 190 3 ybgP Uncharacterized fimbrial chaperone YbgP Escherichia coli (strain K12)
P77249 2.58e-15 75 26 4 188 2 sfmC Probable fimbrial chaperone SfmC Escherichia coli (strain K12)
P37923 2.82e-15 75 27 5 187 3 fimC Chaperone protein FimC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P21646 7.63e-15 74 22 5 193 3 mrkB Chaperone protein MrkB Klebsiella pneumoniae
P33342 1.75e-14 73 23 5 200 2 yehC Probable fimbrial chaperone YehC Escherichia coli (strain K12)
P25402 3.66e-14 72 27 6 213 3 fanE Chaperone protein FanE Escherichia coli
P33409 2.15e-13 70 23 7 214 3 fimB Chaperone protein FimB/FhaD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P53520 8.56e-13 68 25 4 173 3 pmfD Chaperone protein PmfD Proteus mirabilis (strain HI4320)
P25401 1.13e-12 68 22 4 175 1 faeE Chaperone protein FaeE Escherichia coli
P33128 1.19e-12 68 22 9 237 1 yadV Probable fimbrial chaperone YadV Escherichia coli (strain K12)
P77616 2.83e-12 67 22 7 198 3 yqiH Uncharacterized fimbrial chaperone YqiH Escherichia coli (strain K12)
Q05433 6.15e-12 66 22 4 175 3 clpE Chaperone protein ClpE Escherichia coli
P46004 8.29e-10 60 26 8 214 3 aggD Chaperone protein AggD Escherichia coli
P33387 1.48e-09 59 28 3 171 3 sefB Chaperone protein SefB Salmonella enteritidis
P40876 9.7e-09 57 20 8 222 2 ycbF Uncharacterized fimbrial chaperone YcbF Escherichia coli (strain K12)
P77599 4.43e-08 55 25 4 158 2 yfcS Probable fimbrial chaperone YfcS Escherichia coli (strain K12)
P35757 1.18e-07 54 22 9 231 3 hifB Chaperone protein HifB Haemophilus influenzae
P45991 2.44e-07 53 21 9 232 3 hifB Chaperone protein HifB Haemophilus influenzae
P53516 5.83e-07 52 25 5 156 3 afaB Chaperone protein AfaB Escherichia coli
P26926 2.86e-06 50 22 5 174 1 caf1M Chaperone protein caf1M Yersinia pestis

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05730
Feature type CDS
Gene -
Product molecular chaperone
Location 1248802 - 1249503 (strand: -1)
Length 702 (nucleotides) / 233 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3650
Orthogroup size 4
N. genomes 2

Actions

Genomic region

Domains

PF00345 Pili and flagellar-assembly chaperone, PapD N-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3121 Extracellular structures (W) W P pilus assembly protein, chaperone PapD

Protein Sequence

MIKKYIVYIISFVFTFSCYASIQINKDRFFYKEQDKEILFDIRNKSEQKTYIIQSWVSHYNKEDNSEAPFIISPSLIRLAPNENFTLKIIKTDDIKEINQESVYRVNIKLVPVIDDEMADKNLLLISLNSIYNLFYTPSNIINKSDNKDINFFINDENFIKINNPTPYFITIAEAKVDNIDILNERITLSPFKNYSIKNKKITKNIKDKKVHWKRVDEYEQTIIATPKELIYE

Flanking regions ( +/- flanking 50bp)

TTATGGATTAATATAATAAATAACTTAACTAATGGTTAATTAAAAAACATATGATTAAAAAATATATTGTTTATATAATATCATTTGTCTTTACATTCTCATGTTATGCTTCTATTCAAATTAATAAGGATAGATTTTTTTATAAAGAACAAGATAAGGAAATTCTATTTGACATAAGAAATAAAAGCGAACAAAAAACCTATATTATTCAAAGTTGGGTATCACACTATAACAAAGAAGATAATAGTGAGGCACCATTTATCATTTCTCCTAGTTTAATAAGATTAGCACCCAATGAAAATTTTACATTAAAAATTATCAAAACGGATGATATAAAAGAAATCAACCAAGAATCTGTATATAGAGTAAATATAAAATTAGTTCCAGTTATAGATGATGAGATGGCTGATAAAAACCTGCTCCTTATCTCTTTAAACTCAATATATAATCTTTTCTATACACCTAGCAATATTATTAACAAAAGTGATAATAAAGATATTAATTTTTTTATTAATGATGAAAATTTTATTAAAATAAACAACCCCACTCCTTATTTTATTACCATAGCAGAAGCAAAGGTAGATAACATTGATATATTAAATGAGCGAATAACCCTATCGCCATTTAAAAATTACAGTATAAAAAATAAAAAAATAACTAAAAATATTAAAGATAAAAAAGTACATTGGAAGAGAGTCGATGAGTATGAGCAGACTATCATTGCAACCCCAAAGGAACTTATTTATGAGTAAGATAAGTTTTAGACTAAAAACATCTTTGCTATTGATATTAAATGCATACC