Homologs in group_78

Help

12 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20065 FBDBKF_20065 32.3 Morganella morganii S1 fimA type 1 fimbrial major subunit FimA
EHELCC_03465 EHELCC_03465 32.3 Morganella morganii S2 fimA type 1 fimbrial major subunit FimA
NLDBIP_03465 NLDBIP_03465 32.3 Morganella morganii S4 fimA type 1 fimbrial major subunit FimA
LHKJJB_09295 LHKJJB_09295 32.3 Morganella morganii S3 fimA type 1 fimbrial major subunit FimA
HKOGLL_09680 HKOGLL_09680 32.3 Morganella morganii S5 fimA type 1 fimbrial major subunit FimA
F4V73_RS01035 F4V73_RS01035 22.9 Morganella psychrotolerans - fimbrial protein
F4V73_RS01685 F4V73_RS01685 31.1 Morganella psychrotolerans fimA type 1 fimbrial major subunit FimA
PMI_RS10910 PMI_RS10910 29.7 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS13445 PMI_RS13445 24.0 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS13460 PMI_RS13460 39.0 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS16670 PMI_RS16670 24.4 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS17120 PMI_RS17120 29.1 Proteus mirabilis HI4320 fimA type 1 fimbrial major subunit FimA

Distribution of the homologs in the orthogroup group_78

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_78

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P08189 2.74e-56 178 51 0 165 1 fimF Protein FimF Escherichia coli (strain K12)
P77789 8.44e-38 130 40 0 164 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
P13429 1.6e-26 102 37 4 156 1 sfaG S-fimbrial protein subunit SfaG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P37921 4.84e-19 83 34 4 153 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P75860 3.3e-18 80 33 5 170 2 ycbV Uncharacterized fimbrial-like protein YcbV Escherichia coli (strain K12)
P55223 4.72e-18 80 33 4 153 3 None Fimbrial subunit type 1 Salmonella typhimurium
P37920 5.72e-16 75 33 5 153 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P43660 8.67e-16 74 31 6 170 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P39264 3.88e-13 67 28 4 152 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P22595 4.67e-13 67 27 3 169 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
Q8X5K5 3.71e-12 64 26 3 158 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P13421 3.63e-09 56 28 5 177 1 smfA Fimbria A protein Serratia marcescens
P38052 6.6e-09 55 30 3 150 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
P12903 1.49e-08 55 32 4 109 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P75859 4.1e-08 53 26 6 182 2 ycbU Uncharacterized fimbrial-like protein YcbU Escherichia coli (strain K12)
P0ABW5 5.12e-08 53 28 4 155 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 5.12e-08 53 28 4 155 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
Q47223 1.41e-07 52 29 7 184 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P45992 8.09e-07 50 27 6 167 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P76499 1.16e-06 49 28 5 157 2 yfcP Uncharacterized fimbrial-like protein YfcP Escherichia coli (strain K12)
P04128 2.33e-06 48 28 5 154 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
P37926 9.8e-06 47 26 3 149 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45993 1.67e-05 47 28 2 110 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P11312 2.74e-05 45 24 4 160 3 F17a-A F17 fimbrial protein Escherichia coli
P12266 6.44e-05 45 26 3 153 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P37922 6.7e-05 44 23 4 151 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q08456 0.000115 44 23 4 151 5 fimI Putative fimbrin-like protein FimI Salmonella typhi

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17135
Feature type CDS
Gene -
Product fimbrial protein
Location 3770418 - 3770960 (strand: 1)
Length 543 (nucleotides) / 180 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_78
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07348 minor fimbrial subunit - -

Protein Sequence

MTNNIKGILTTLWLFFLSLSPNVAYSADSIIQITGYMRDNTCAVAPESQYQTIDLLNNEVKRLYKVGETTPFIPFHIILEPCGESVIAVKFYFNGISDRNNPSLLALDPIATSASGVGIQILDSERSPIPINPSSDQLKWIPLVAGKSNTVFFYSRLMASDMPVLAGKIKASATFTLEYQ

Flanking regions ( +/- flanking 50bp)

AACTTTATGTTGAATATAGTGCAGAGTGCCACCCTATTAAGGAATAAATAATGACTAATAATATTAAGGGTATTTTGACAACACTATGGTTATTTTTCTTATCATTATCACCTAATGTTGCATATTCTGCCGATAGCATTATTCAAATAACAGGTTATATGAGAGATAACACCTGTGCAGTTGCACCAGAATCACAATACCAAACTATTGATTTATTAAATAATGAAGTTAAGCGGTTATATAAAGTGGGAGAAACAACACCCTTTATTCCTTTTCATATAATACTGGAACCTTGTGGAGAATCAGTGATTGCTGTGAAATTCTATTTTAATGGTATTTCAGATAGAAATAATCCTTCATTATTAGCGTTAGATCCGATAGCAACATCTGCTTCTGGTGTTGGAATACAAATATTAGATAGTGAAAGGTCACCCATTCCTATTAATCCAAGTAGTGACCAACTTAAATGGATCCCCTTAGTTGCAGGAAAAAGTAACACCGTTTTTTTCTATAGTCGATTAATGGCATCCGATATGCCTGTCTTAGCTGGAAAAATTAAAGCCAGTGCCACTTTTACACTCGAGTACCAATAGAGATAAAGAGAATCAATGATGAAATATAAATGGCGAGGAGTAAAAAACGT