Homologs in group_198

Help

7 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS10280 F4V73_RS10280 21.6 Morganella psychrotolerans - fimbrial protein
PMI_RS05775 PMI_RS05775 23.6 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS10890 PMI_RS10890 24.0 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS10895 PMI_RS10895 26.8 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS10910 PMI_RS10910 45.0 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS12555 PMI_RS12555 22.2 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS17140 PMI_RS17140 22.2 Proteus mirabilis HI4320 - fimbrial protein

Distribution of the homologs in the orthogroup group_198

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_198

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P12730 9.95e-20 84 35 3 159 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P39264 1.33e-17 79 29 5 185 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P11312 4.39e-17 77 37 3 157 3 F17a-A F17 fimbrial protein Escherichia coli
P43660 4.63e-17 77 33 5 177 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37920 5.3e-17 77 35 5 160 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P77789 2.31e-16 75 31 5 169 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
P12903 1.02e-15 73 35 7 189 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P55223 2.5e-15 73 35 7 162 3 None Fimbrial subunit type 1 Salmonella typhimurium
P37921 2.96e-15 72 34 7 162 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P62605 1.13e-14 71 33 4 160 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 1.13e-14 71 33 4 160 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P04128 4.06e-14 69 37 4 152 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
Q8X5K5 4.13e-14 69 31 6 179 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
Q47223 1.64e-13 68 37 7 162 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P38052 2.79e-13 67 33 7 153 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
Q8X582 4.97e-13 67 31 3 155 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
P37922 6.48e-13 66 23 3 177 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P75855 3.63e-12 64 30 3 155 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
Q08456 4.99e-12 64 23 3 177 5 fimI Putative fimbrin-like protein FimI Salmonella typhi
P08189 8.16e-12 63 29 4 175 1 fimF Protein FimF Escherichia coli (strain K12)
P45988 1.49e-11 63 27 5 185 3 hifA Major fimbrial subunit Haemophilus influenzae
P12266 1.52e-11 63 37 5 154 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P45992 2.65e-11 62 33 7 181 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P0ABW5 3.58e-11 62 33 5 163 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 3.58e-11 62 33 5 163 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
P22595 1.15e-10 60 30 5 162 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
Q03011 1.81e-10 60 28 4 176 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P43664 8.58e-10 58 31 7 180 3 lpfE Protein LpfE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P13429 2.97e-09 56 30 5 141 1 sfaG S-fimbrial protein subunit SfaG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8X5L0 1.02e-08 55 31 5 170 2 lpfE Probable fimbrial subunit LpfE Escherichia coli O157:H7
P37909 1.06e-08 55 28 8 192 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
P42913 3.59e-08 53 27 8 196 2 yraH Uncharacterized fimbrial-like protein YraH Escherichia coli (strain K12)
P14212 4.29e-08 53 27 6 187 1 hifA Major fimbrial subunit Haemophilus influenzae
P45989 4.93e-08 53 27 6 187 3 hifA Major fimbrial subunit Haemophilus influenzae
P45993 6.39e-08 53 29 3 131 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P09808 7.33e-08 53 41 3 85 3 fimX Fimbrial protein FimX Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P62532 3.1e-07 51 26 4 157 1 papK Fimbrial adapter PapK Escherichia coli
P62533 3.1e-07 51 26 4 157 3 papK Fimbrial adapter PapK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B2FNJ0 8.97e-07 49 38 8 159 1 smf-1 Major fimbrial subunit SMF-1 Stenotrophomonas maltophilia (strain K279a)
P21413 1.07e-06 50 31 6 132 3 fasA Fimbrial protein 987P Escherichia coli
P77294 1.29e-06 49 30 2 85 3 ydeR Uncharacterized fimbrial-like protein YdeR Escherichia coli (strain K12)
P05788 2.47e-06 48 34 5 125 3 fim2 Serotype 2 fimbrial subunit Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q03846 6.87e-06 47 23 5 209 3 hifA Major fimbrial subunit Haemophilus influenzae
P13421 8.16e-06 47 33 3 114 1 smfA Fimbria A protein Serratia marcescens
P53521 1.19e-05 47 25 7 177 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)
P08190 1.19e-05 46 38 2 71 1 fimG Protein FimG Escherichia coli (strain K12)
P77288 1.66e-05 46 32 2 86 2 yfcV Uncharacterized fimbrial-like protein YfcV Escherichia coli (strain K12)
P37926 3.31e-05 45 27 7 174 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P17835 4.63e-05 45 40 1 64 3 fim3 Serotype 3 fimbrial subunit Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P62607 5.41e-05 45 29 4 120 3 F7-2 F7-2 fimbrial protein Escherichia coli
P62608 5.41e-05 45 29 4 120 3 F7-2 F7-2 fimbrial protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q04681 6.23e-05 45 30 8 156 1 pmfA Major fimbrial subunit Proteus mirabilis (strain HI4320)
P42191 6.37e-05 44 26 5 157 1 prsK Protein PrsK Escherichia coli
P45990 6.69e-05 45 23 3 187 3 hifA Major fimbrial subunit Haemophilus influenzae
P39834 7.9e-05 44 28 11 200 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
P42184 0.00036 42 31 2 85 1 prsA PRS fimbrial major pilin protein (Fragment) Escherichia coli

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16670
Feature type CDS
Gene -
Product fimbrial protein
Location 3675266 - 3675787 (strand: -1)
Length 522 (nucleotides) / 173 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_198
Orthogroup size 8
N. genomes 2

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07345 major type 1 subunit fimbrin (pilin) Shigellosis
Pertussis		 -

Protein Sequence

MSKLNKSLCALGVTLSIFSAPAALASGTINFTGEITDQACTVDGSSKNLTVDLGKVSSKSLATKGEVAGLKDFTIKLIDCPVDTTVAVRFGGTRDASDRDILAIDQVSGGATNVGIALFEKDAVSQIKLYDDSQDVQITGTEINLDYVARYKATDAATPGPANGSAVYSIQYK

Flanking regions ( +/- flanking 50bp)

TATAAATAGATTAAAAAGTAAGTTCGCTTACTTTTTATATAGGACCGATCATGAGCAAATTAAATAAATCACTCTGTGCATTAGGAGTGACTCTTTCTATATTCTCAGCACCTGCTGCTTTAGCATCAGGCACAATTAACTTTACGGGAGAAATAACCGATCAAGCATGTACTGTTGATGGCTCTTCTAAAAACTTAACCGTCGACTTAGGCAAAGTTTCTTCTAAAAGCTTAGCAACCAAAGGGGAAGTTGCTGGCCTGAAAGATTTTACCATTAAATTAATCGACTGCCCTGTTGATACCACGGTAGCCGTACGTTTTGGCGGTACTCGTGATGCAAGCGACAGAGATATCTTAGCTATAGATCAAGTTTCTGGTGGCGCAACTAACGTAGGTATCGCGTTATTTGAGAAAGATGCTGTTTCCCAAATCAAACTGTATGACGATTCACAAGATGTACAGATCACAGGTACGGAAATTAACCTAGACTACGTTGCTCGTTATAAAGCAACTGATGCGGCAACACCAGGCCCTGCCAATGGCTCTGCTGTATATAGCATCCAATATAAATAATAAATGATAAATATGAGGGTAATCACCATTACCCTCTCACCTCTCCTCAA