Homologs in group_197

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20065 FBDBKF_20065 85.0 Morganella morganii S1 fimA type 1 fimbrial major subunit FimA
EHELCC_03465 EHELCC_03465 85.0 Morganella morganii S2 fimA type 1 fimbrial major subunit FimA
NLDBIP_03465 NLDBIP_03465 85.0 Morganella morganii S4 fimA type 1 fimbrial major subunit FimA
LHKJJB_09295 LHKJJB_09295 85.0 Morganella morganii S3 fimA type 1 fimbrial major subunit FimA
HKOGLL_09680 HKOGLL_09680 85.0 Morganella morganii S5 fimA type 1 fimbrial major subunit FimA
F4V73_RS01035 F4V73_RS01035 36.4 Morganella psychrotolerans - fimbrial protein
PMI_RS17120 PMI_RS17120 52.8 Proteus mirabilis HI4320 fimA type 1 fimbrial major subunit FimA

Distribution of the homologs in the orthogroup group_197

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_197

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37920 4.86e-63 195 57 3 185 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P37921 9.17e-62 192 57 4 186 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P55223 7.32e-60 187 58 2 178 3 None Fimbrial subunit type 1 Salmonella typhimurium
P62605 4.59e-48 157 51 3 182 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 4.59e-48 157 51 3 182 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABW5 3.74e-46 152 50 2 182 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 3.74e-46 152 50 2 182 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
P12730 2.33e-44 147 47 2 182 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P12903 9.97e-44 146 51 3 183 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
Q47223 4.64e-42 142 52 5 187 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P04128 2.99e-39 135 53 2 156 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
P12266 3.74e-38 132 53 2 160 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P43660 1.4e-29 110 43 5 174 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X5K5 9.44e-25 97 41 3 153 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
Q08456 3.66e-21 88 34 7 178 5 fimI Putative fimbrin-like protein FimI Salmonella typhi
P37922 1.46e-20 86 32 6 174 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37926 7.12e-19 82 35 6 173 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P39264 7.87e-18 79 29 3 168 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P38052 3.01e-16 75 35 9 177 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
P45992 1.22e-15 74 33 5 172 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P22595 7.56e-15 72 32 5 170 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
P13421 4.97e-14 69 32 6 184 1 smfA Fimbria A protein Serratia marcescens
Q8X582 6.22e-13 67 30 6 186 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
Q03011 1.17e-12 65 34 5 183 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P75855 1.3e-12 65 29 5 184 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
P04127 5.44e-12 64 30 7 194 1 papA Pap fimbrial major pilin protein Escherichia coli
P62607 8.64e-12 63 31 5 190 3 F7-2 F7-2 fimbrial protein Escherichia coli
P62608 8.64e-12 63 31 5 190 3 F7-2 F7-2 fimbrial protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P08189 1.1e-11 63 35 7 173 1 fimF Protein FimF Escherichia coli (strain K12)
P42184 8.92e-11 60 34 4 133 1 prsA PRS fimbrial major pilin protein (Fragment) Escherichia coli
P77789 1e-10 60 28 5 181 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
P14212 1.45e-10 61 26 5 215 1 hifA Major fimbrial subunit Haemophilus influenzae
P04740 3.77e-10 59 29 4 172 3 KS71A KS71A fimbrillin Escherichia coli
P45989 5.62e-10 59 26 5 215 3 hifA Major fimbrial subunit Haemophilus influenzae
P45988 1.36e-09 58 26 6 215 3 hifA Major fimbrial subunit Haemophilus influenzae
P13429 2.06e-09 57 30 6 184 1 sfaG S-fimbrial protein subunit SfaG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P45993 4.12e-09 57 35 2 103 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P75860 9.55e-08 52 30 5 155 2 ycbV Uncharacterized fimbrial-like protein YcbV Escherichia coli (strain K12)
Q04681 3.49e-07 51 29 6 161 1 pmfA Major fimbrial subunit Proteus mirabilis (strain HI4320)
P53521 5.19e-07 50 22 4 185 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)
P39834 2.98e-06 48 28 6 161 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
P11312 3.55e-06 48 27 4 158 3 F17a-A F17 fimbrial protein Escherichia coli
P43664 3.74e-06 48 28 7 181 3 lpfE Protein LpfE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q03846 3.99e-06 48 25 6 220 3 hifA Major fimbrial subunit Haemophilus influenzae
P42913 3.05e-05 46 26 6 172 2 yraH Uncharacterized fimbrial-like protein YraH Escherichia coli (strain K12)
P37909 3.48e-05 45 25 7 186 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
P21413 0.000292 43 29 6 148 3 fasA Fimbrial protein 987P Escherichia coli
P45990 0.000391 43 25 1 131 3 hifA Major fimbrial subunit Haemophilus influenzae

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01685
Feature type CDS
Gene fimA
Product type 1 fimbrial major subunit FimA
Location 370376 - 370921 (strand: -1)
Length 546 (nucleotides) / 181 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_197
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07352 type 1 fimbrial protein - -

Protein Sequence

MKLNIIGASVVSALLFSAAASADPVIVNGGTVHFNGELVNAACAVSTDTGNQTVELGQYRTAKLAAAGDMTTPVPFKIKLVDCDPTVSATAAIAFSGQSLTGDATLLAVNSGTNAPAAQNVGIQISDTASKVLPPSGAEFSTAKTLLEGTNTLDFTARYVAKGATTPGQANADATFVVKYE

Flanking regions ( +/- flanking 50bp)

ACAGATAGTAAAATTTAAAGATGGCGTTTATTTTTTAGGAATTCAGTATTATGAAATTAAATATTATTGGTGCATCTGTTGTTTCAGCATTATTATTTTCCGCAGCCGCGTCTGCTGACCCGGTAATCGTAAATGGCGGTACTGTTCATTTTAATGGTGAACTGGTTAACGCTGCGTGTGCAGTCAGCACCGATACCGGCAACCAGACCGTTGAATTAGGTCAGTACCGTACTGCTAAATTAGCAGCAGCCGGTGATATGACTACACCGGTTCCTTTCAAAATCAAATTAGTTGACTGTGACCCTACTGTTTCAGCGACTGCGGCAATCGCTTTCTCCGGCCAGAGCCTGACAGGTGATGCAACGTTATTAGCTGTTAATTCAGGCACTAACGCACCAGCAGCACAGAACGTCGGTATTCAGATCAGCGATACCGCATCTAAAGTATTACCGCCAAGTGGTGCAGAATTCTCTACCGCTAAAACCTTACTCGAAGGAACGAATACCTTAGATTTCACTGCCCGTTATGTTGCTAAAGGCGCAACAACACCGGGTCAGGCAAATGCTGATGCAACGTTTGTTGTTAAATACGAATAAGTTAAATACGAATAACAAATTACGTTCAGTAATTAAATAATTAAAAGCTC