Homologs in group_197

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20065 FBDBKF_20065 100.0 Morganella morganii S1 fimA type 1 fimbrial major subunit FimA
EHELCC_03465 EHELCC_03465 100.0 Morganella morganii S2 fimA type 1 fimbrial major subunit FimA
LHKJJB_09295 LHKJJB_09295 100.0 Morganella morganii S3 fimA type 1 fimbrial major subunit FimA
HKOGLL_09680 HKOGLL_09680 100.0 Morganella morganii S5 fimA type 1 fimbrial major subunit FimA
F4V73_RS01035 F4V73_RS01035 35.8 Morganella psychrotolerans - fimbrial protein
F4V73_RS01685 F4V73_RS01685 85.0 Morganella psychrotolerans fimA type 1 fimbrial major subunit FimA
PMI_RS17120 PMI_RS17120 53.3 Proteus mirabilis HI4320 fimA type 1 fimbrial major subunit FimA

Distribution of the homologs in the orthogroup group_197

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_197

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37920 1.03e-63 197 58 2 184 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P37921 4.45e-63 195 58 3 185 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P55223 3.52e-60 188 58 3 185 3 None Fimbrial subunit type 1 Salmonella typhimurium
P0ABW5 3.3e-47 155 53 3 183 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 3.3e-47 155 53 3 183 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
P12903 1.36e-44 148 52 1 182 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P62605 2.24e-44 147 49 3 182 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 2.24e-44 147 49 3 182 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q47223 6.01e-44 147 54 4 185 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P12730 9.2e-42 141 47 2 182 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P04128 5.87e-41 139 57 3 156 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
P12266 4.62e-40 137 54 3 183 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
Q8X5K5 3.92e-25 98 42 4 153 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P43660 2.7e-23 94 41 4 153 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q08456 3.83e-23 93 35 6 177 5 fimI Putative fimbrin-like protein FimI Salmonella typhi
P37922 1.88e-22 91 35 6 177 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P13421 6.77e-19 82 35 5 184 1 smfA Fimbria A protein Serratia marcescens
P45992 4.63e-14 70 35 7 171 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
Q03011 1.27e-13 68 31 6 188 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P39264 2.08e-13 68 31 4 154 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P38052 4.44e-13 67 33 10 178 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
P37926 4.77e-13 67 35 6 150 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P22595 1.18e-12 66 32 7 171 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
P14212 1.32e-12 66 29 7 218 1 hifA Major fimbrial subunit Haemophilus influenzae
P42184 4.07e-12 64 32 2 133 1 prsA PRS fimbrial major pilin protein (Fragment) Escherichia coli
P45989 5.23e-12 65 28 7 218 3 hifA Major fimbrial subunit Haemophilus influenzae
P62607 1.1e-11 63 29 4 190 3 F7-2 F7-2 fimbrial protein Escherichia coli
P62608 1.1e-11 63 29 4 190 3 F7-2 F7-2 fimbrial protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P04740 4.24e-11 62 29 4 168 3 KS71A KS71A fimbrillin Escherichia coli
P45988 2.23e-10 60 31 12 220 3 hifA Major fimbrial subunit Haemophilus influenzae
Q8X582 2.28e-10 60 28 7 187 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
P04127 3.4e-10 59 31 7 188 1 papA Pap fimbrial major pilin protein Escherichia coli
P77789 4.19e-10 59 32 8 174 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
P75855 4.22e-10 59 28 6 185 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
P37909 5.99e-10 58 26 4 183 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
P08189 6.85e-10 58 33 8 178 1 fimF Protein FimF Escherichia coli (strain K12)
P53521 3.92e-09 56 28 3 134 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)
Q04681 5.1e-09 56 32 5 156 1 pmfA Major fimbrial subunit Proteus mirabilis (strain HI4320)
P39834 6.75e-09 56 30 5 160 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
P75860 3.91e-08 53 28 4 169 2 ycbV Uncharacterized fimbrial-like protein YcbV Escherichia coli (strain K12)
P43664 4.78e-08 53 30 5 179 3 lpfE Protein LpfE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45993 3.35e-06 48 33 3 106 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P42913 9.3e-06 47 26 8 186 2 yraH Uncharacterized fimbrial-like protein YraH Escherichia coli (strain K12)
P21413 0.000109 44 27 3 129 3 fasA Fimbrial protein 987P Escherichia coli
Q03846 0.000119 44 24 7 220 3 hifA Major fimbrial subunit Haemophilus influenzae
P13429 0.00013 43 29 7 156 1 sfaG S-fimbrial protein subunit SfaG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P11312 0.000688 42 28 5 157 3 F17a-A F17 fimbrial protein Escherichia coli

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_03465
Feature type CDS
Gene fimA
Product type 1 fimbrial major subunit FimA
Location 884 - 1429 (strand: 1)
Length 546 (nucleotides) / 181 (amino acids)
In genomic island -

Contig

Accession ZDB_520
Length 336657 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_197
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07352 type 1 fimbrial protein - -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG042679 major fimbrial subunit VF1211 Adherence

Protein Sequence

MKLNIIGASVVSALLFSAAASAADPVIVNGGTVHFTGELVNAACAVSTESSNQTVELGQYRTATLTGSAMSTPVPFKIKLVDCDPTVATTAAVAFSGQSMAGDVNLLAVTSGTNAPAAQNVGIQISDATSAVLPPNGADFSAAKTLIQGTNVLDFTARYVAKGATTPGQANADATFVVKYE

Flanking regions ( +/- flanking 50bp)

TGAGATAGTAAAATTTGAAGATGGCGTTTATTTTTTAGGAATTCAGTATTATGAAATTAAATATTATTGGTGCATCTGTTGTATCCGCTTTATTATTCTCAGCTGCTGCATCAGCAGCAGATCCTGTAATCGTAAACGGCGGTACAGTTCATTTTACCGGGGAACTGGTTAACGCAGCATGCGCAGTCAGCACTGAAAGCAGCAACCAGACTGTGGAATTAGGTCAGTACCGTACAGCTACCTTAACCGGAAGTGCTATGTCTACTCCGGTTCCGTTCAAAATCAAACTGGTTGACTGTGATCCGACTGTGGCAACCACCGCTGCAGTTGCATTCTCAGGCCAGAGCATGGCCGGCGACGTTAACTTATTAGCGGTTACCTCCGGGACTAACGCACCGGCTGCACAGAACGTCGGTATTCAGATCAGCGATGCCACATCTGCCGTATTACCACCAAACGGTGCTGATTTCTCAGCAGCTAAAACCTTAATCCAAGGTACTAACGTATTAGATTTCACTGCCCGTTATGTTGCCAAAGGCGCAACTACCCCGGGTCAGGCAAATGCTGATGCAACTTTCGTTGTTAAATACGAATAATCAATTACCGAACGTAATTAATTAAATAAATAAAAACTCTCTCTGCACAG