Homologs in group_4078

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4078

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4078

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37921 8.11e-36 126 40 4 190 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37920 1.39e-34 123 40 5 190 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P55223 1.12e-32 118 38 3 190 3 None Fimbrial subunit type 1 Salmonella typhimurium
P62605 5.63e-30 111 42 5 177 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 5.63e-30 111 42 5 177 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P12903 2.96e-28 107 45 3 138 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
Q47223 5.51e-28 106 46 4 138 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P43660 6.23e-28 106 36 3 186 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P04128 1.9e-24 97 50 2 103 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
P12730 7.94e-24 95 37 5 177 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P12266 2.13e-23 94 47 1 104 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P0ABW5 7.02e-22 90 40 3 155 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 7.02e-22 90 40 3 155 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
Q03011 9.36e-18 79 33 6 190 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P39264 1.07e-17 79 28 3 154 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
Q8X5K5 1.59e-16 76 32 3 172 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P75855 4.71e-15 72 31 6 188 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
Q8X582 7.85e-14 69 31 6 188 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
P37922 1.1e-13 68 24 4 173 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P38052 2.08e-13 68 29 3 147 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
Q08456 4.17e-13 67 23 4 173 5 fimI Putative fimbrin-like protein FimI Salmonella typhi
P37926 5.19e-13 67 32 5 152 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P43664 1.2e-12 66 33 4 151 3 lpfE Protein LpfE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P62607 3.67e-12 65 29 8 200 3 F7-2 F7-2 fimbrial protein Escherichia coli
P62608 3.67e-12 65 29 8 200 3 F7-2 F7-2 fimbrial protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P04740 1.04e-11 63 30 6 162 3 KS71A KS71A fimbrillin Escherichia coli
P13421 4.93e-11 61 29 3 149 1 smfA Fimbria A protein Serratia marcescens
P13429 9.4e-11 61 28 2 153 1 sfaG S-fimbrial protein subunit SfaG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P22595 6.59e-10 58 29 3 158 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
P08189 6.78e-10 58 31 4 151 1 fimF Protein FimF Escherichia coli (strain K12)
Q04681 2.1e-09 57 28 7 190 1 pmfA Major fimbrial subunit Proteus mirabilis (strain HI4320)
Q8X5L0 4.66e-09 56 30 8 188 2 lpfE Probable fimbrial subunit LpfE Escherichia coli O157:H7
P37909 5.77e-09 56 25 6 183 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
P42184 7.21e-09 55 29 7 158 1 prsA PRS fimbrial major pilin protein (Fragment) Escherichia coli
P75860 8.8e-08 52 26 3 160 2 ycbV Uncharacterized fimbrial-like protein YcbV Escherichia coli (strain K12)
P42913 1.11e-07 53 30 3 116 2 yraH Uncharacterized fimbrial-like protein YraH Escherichia coli (strain K12)
P45992 6.77e-07 51 27 5 183 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P04127 9.28e-07 50 27 6 159 1 papA Pap fimbrial major pilin protein Escherichia coli
P77789 1.36e-06 49 27 3 150 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
P75859 2.25e-06 49 24 4 165 2 ycbU Uncharacterized fimbrial-like protein YcbU Escherichia coli (strain K12)
P53521 3.2e-06 48 24 2 136 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)
P39834 7.8e-06 47 28 6 158 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
P45993 3.89e-05 45 28 3 119 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P42185 0.000136 44 23 3 155 3 prsH PRS fimbrial minor pilin protein Escherichia coli
P21413 0.000142 44 28 3 112 3 fasA Fimbrial protein 987P Escherichia coli
Q03846 0.000205 43 31 1 98 3 hifA Major fimbrial subunit Haemophilus influenzae

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13445
Feature type CDS
Gene -
Product fimbrial protein
Location 2979093 - 2979653 (strand: 1)
Length 561 (nucleotides) / 186 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4078
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07345 major type 1 subunit fimbrin (pilin) Shigellosis
Pertussis
-

Protein Sequence

MKKLLLSAIITSAMAIIATPALAEDTGTPAPTEVTVNGGTINFEGSVVNAACGVDSSSSNQTVRLGQFRVAEFTKKGDETGRIPFSIKLNNCDITVSSLAAITFNGTASDGDATAFALQGSGAATNVALKITDSSSKNVVPGQPSSTQKLIEGENQLNYNASLISTDDTVKAGSANVTTNFMVTYS

Flanking regions ( +/- flanking 50bp)

ATTTTATTAAGCTAAGTATTAAATATATATTGAAAATATAGGAACATTTAATGAAAAAGTTATTATTATCTGCAATTATTACTTCAGCAATGGCCATAATTGCTACACCTGCCCTAGCAGAAGATACTGGTACACCAGCACCAACAGAAGTTACAGTTAATGGTGGTACTATTAACTTTGAAGGTTCTGTCGTTAATGCTGCTTGTGGTGTTGATAGTAGTTCAAGTAACCAAACTGTTCGTTTGGGTCAATTCCGTGTCGCTGAATTCACTAAAAAAGGTGATGAAACAGGACGTATTCCTTTTAGCATTAAATTAAATAACTGCGATATTACTGTTTCATCATTAGCAGCAATTACCTTTAACGGTACAGCTTCTGATGGTGATGCAACTGCATTCGCATTACAAGGCAGTGGCGCAGCAACCAATGTAGCGTTAAAAATTACCGATTCAAGCAGCAAAAATGTTGTTCCAGGACAACCTTCTTCAACTCAAAAATTAATCGAAGGTGAAAACCAATTAAATTATAACGCTTCTCTTATTTCCACTGATGATACAGTGAAGGCAGGTAGCGCAAACGTTACAACTAACTTTATGGTGACTTACTCTTAATCACTTCATCACTTTTGATTGATGTCTTATCGCCAAGGACGGCCTATTTT