Homologs in group_78

Help

12 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20065 FBDBKF_20065 35.6 Morganella morganii S1 fimA type 1 fimbrial major subunit FimA
EHELCC_03465 EHELCC_03465 35.6 Morganella morganii S2 fimA type 1 fimbrial major subunit FimA
NLDBIP_03465 NLDBIP_03465 35.6 Morganella morganii S4 fimA type 1 fimbrial major subunit FimA
LHKJJB_09295 LHKJJB_09295 35.6 Morganella morganii S3 fimA type 1 fimbrial major subunit FimA
HKOGLL_09680 HKOGLL_09680 35.6 Morganella morganii S5 fimA type 1 fimbrial major subunit FimA
F4V73_RS01685 F4V73_RS01685 36.7 Morganella psychrotolerans fimA type 1 fimbrial major subunit FimA
PMI_RS10910 PMI_RS10910 25.9 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS13445 PMI_RS13445 33.1 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS13460 PMI_RS13460 26.1 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS16670 PMI_RS16670 33.7 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS17120 PMI_RS17120 35.0 Proteus mirabilis HI4320 fimA type 1 fimbrial major subunit FimA
PMI_RS17135 PMI_RS17135 22.9 Proteus mirabilis HI4320 - fimbrial protein

Distribution of the homologs in the orthogroup group_78

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_78

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37921 3.62e-22 91 38 7 185 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37920 1.17e-21 90 38 6 183 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P62605 1.29e-19 84 39 7 182 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 1.29e-19 84 39 7 182 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P55223 4.63e-19 83 37 6 164 3 None Fimbrial subunit type 1 Salmonella typhimurium
Q8X582 2.68e-17 78 27 1 177 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
P75855 5.56e-17 77 27 1 177 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
P12730 8.57e-17 77 36 9 185 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P12903 1.93e-14 70 35 6 187 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P43660 6.08e-12 64 29 3 162 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q47223 1.07e-11 63 35 8 189 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
Q8X5K5 1.39e-11 63 28 4 169 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P37922 3.65e-11 62 26 4 176 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P12266 1.39e-10 60 37 5 162 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P04128 4.61e-10 59 36 6 160 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
Q08456 5.17e-10 58 25 4 175 5 fimI Putative fimbrin-like protein FimI Salmonella typhi
P0ABW5 5.21e-10 58 35 6 159 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 5.21e-10 58 35 6 159 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
P45992 9.99e-09 56 32 6 162 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
Q03011 1.3e-06 49 34 3 99 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
Q04681 1.54e-06 49 28 4 157 1 pmfA Major fimbrial subunit Proteus mirabilis (strain HI4320)
P39264 1.86e-05 46 22 3 149 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P11312 4.83e-05 45 31 8 159 3 F17a-A F17 fimbrial protein Escherichia coli
P45988 8.29e-05 45 33 5 116 3 hifA Major fimbrial subunit Haemophilus influenzae
P45993 0.000233 43 29 5 139 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P53521 0.000726 42 28 3 106 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01035
Feature type CDS
Gene -
Product fimbrial protein
Location 221546 - 222097 (strand: 1)
Length 552 (nucleotides) / 183 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_78
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07345 major type 1 subunit fimbrin (pilin) Shigellosis
Pertussis		 -

Protein Sequence

MKINNTKLNIISVVLGLTLAGAAFAAPQTTSISGGTFKFQGEVVDAACAVATSENNGPVVLNQVRTKNLAVSGDLGNQKKPFSIRLIDCDNSVSENVAVSYSAQTDAAIPAALANIANGNTAKNVALQIFGPDSKPLATGVQSSLLKIEGTEVIIPLSVDYIATGAATSGSVRGEATFMIHFS

Flanking regions ( +/- flanking 50bp)

CTTTGTTTTTTACGCTGTGAAAAATAACTTAAAATATGAAAGGAATGGTAATGAAAATTAATAATACTAAATTAAACATAATCTCTGTTGTATTAGGTTTAACATTAGCCGGCGCTGCTTTTGCTGCTCCGCAGACAACATCAATCTCTGGTGGTACTTTTAAATTCCAGGGCGAAGTTGTTGACGCAGCATGTGCTGTTGCAACCAGCGAAAATAATGGTCCTGTCGTACTGAACCAGGTTCGTACAAAAAATTTAGCAGTCAGTGGCGACCTGGGTAACCAGAAAAAACCTTTCTCTATCAGATTAATTGATTGTGACAACTCAGTCAGCGAAAATGTGGCAGTTTCCTATTCTGCACAAACGGATGCGGCTATTCCTGCTGCACTTGCAAATATTGCAAATGGTAATACTGCAAAAAATGTAGCATTACAAATTTTCGGGCCGGATTCTAAGCCATTAGCCACCGGTGTTCAGTCATCATTACTTAAAATTGAAGGTACTGAAGTTATTATCCCGTTAAGTGTTGATTATATTGCTACCGGTGCAGCAACGTCAGGTTCTGTTCGCGGTGAAGCAACATTTATGATTCATTTTTCTTAATAAATAATTTATTCCCTCTTAGTGTTATTAGGGGGGAGTATTTTTATGGC