Homologs in group_77

Help

12 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20045 FBDBKF_20045 27.5 Morganella morganii S1 sfmF fimbria assembly protein
EHELCC_03485 EHELCC_03485 27.5 Morganella morganii S2 sfmF fimbria assembly protein
NLDBIP_03485 NLDBIP_03485 27.5 Morganella morganii S4 sfmF fimbria assembly protein
LHKJJB_09315 LHKJJB_09315 27.5 Morganella morganii S3 sfmF fimbria assembly protein
HKOGLL_09660 HKOGLL_09660 27.5 Morganella morganii S5 sfmF fimbria assembly protein
F4V73_RS00870 F4V73_RS00870 18.8 Morganella psychrotolerans - fimbrial protein
F4V73_RS01060 F4V73_RS01060 23.7 Morganella psychrotolerans - fimbrial protein
F4V73_RS01665 F4V73_RS01665 24.0 Morganella psychrotolerans sfmF fimbria assembly protein
F4V73_RS09370 F4V73_RS09370 18.9 Morganella psychrotolerans - fimbrial protein
F4V73_RS09385 F4V73_RS09385 24.1 Morganella psychrotolerans - fimbrial protein
F4V73_RS10910 F4V73_RS10910 20.0 Morganella psychrotolerans - fimbrial protein
F4V73_RS12590 F4V73_RS12590 25.8 Morganella psychrotolerans - fimbrial protein

Distribution of the homologs in the orthogroup group_77

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_77

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P75859 4.53e-38 131 39 1 174 2 ycbU Uncharacterized fimbrial-like protein YcbU Escherichia coli (strain K12)
P37921 1.04e-20 87 34 6 175 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P55223 3.06e-20 85 35 4 149 3 None Fimbrial subunit type 1 Salmonella typhimurium
P13429 1.44e-18 81 30 4 163 1 sfaG S-fimbrial protein subunit SfaG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P37920 1.39e-16 76 33 7 175 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P22595 1.69e-16 76 34 4 162 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
P77789 1.88e-16 75 31 5 174 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
Q8X5K5 2.57e-15 72 30 4 178 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P08189 4.04e-14 69 30 4 180 1 fimF Protein FimF Escherichia coli (strain K12)
P37922 9.77e-13 66 24 3 162 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q08456 3.1e-12 64 23 3 162 5 fimI Putative fimbrin-like protein FimI Salmonella typhi
P39264 5.69e-12 63 29 4 148 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P0ABW5 3.7e-11 62 31 4 153 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 3.7e-11 62 31 4 153 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
P38052 6.62e-11 61 29 6 179 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
P43660 8.26e-11 60 26 4 178 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q47223 1.87e-10 60 30 4 130 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P75860 3.76e-10 58 27 3 154 2 ycbV Uncharacterized fimbrial-like protein YcbV Escherichia coli (strain K12)
P37926 5.31e-10 58 29 7 176 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P13421 1.04e-09 57 30 6 180 1 smfA Fimbria A protein Serratia marcescens
P13430 1.42e-09 57 29 6 158 1 sfaS S-fimbrial adhesin protein SfaS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P12903 5.45e-08 53 33 4 108 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P04128 6.41e-08 53 29 5 131 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
P12266 8.42e-08 52 28 5 131 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P77294 1.66e-07 52 31 2 89 3 ydeR Uncharacterized fimbrial-like protein YdeR Escherichia coli (strain K12)
P12730 4.3e-07 50 26 7 182 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P62605 1.75e-06 49 26 7 181 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 1.75e-06 49 26 7 181 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P08190 0.000133 43 27 4 130 1 fimG Protein FimG Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01055
Feature type CDS
Gene -
Product fimbrial protein
Location 226520 - 227044 (strand: 1)
Length 525 (nucleotides) / 174 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_77
Orthogroup size 13
N. genomes 6

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07345 major type 1 subunit fimbrin (pilin) Shigellosis
Pertussis		 -

Protein Sequence

MSRFLFLSVFFLFLSNSVNAADVRVSVTGNIKNESCIININDTNQTITLGDFHIRDFPQAGSTTAGKPLNIRLTDCTETISGASVTFTGTASAQYPELLAVSDTGNGTLLAGGIAIEILDGENEKPIALNILTRLKPIIRGENTLKYLLRYKSINNTVTAGDASAIMYFDIIYQ

Flanking regions ( +/- flanking 50bp)

AAACGGACTTGTCGGAATTACTTTTTCCTATCAGTAGCGGGGGAACAATAATGTCACGTTTTTTATTTTTAAGTGTGTTTTTTTTATTTTTAAGCAATAGTGTAAATGCTGCTGATGTGAGGGTGTCTGTTACAGGAAACATTAAAAATGAAAGCTGCATAATTAATATAAATGATACAAATCAAACGATTACACTAGGTGATTTTCATATCAGAGATTTTCCTCAGGCTGGTAGTACAACAGCGGGTAAGCCACTGAATATAAGATTAACGGATTGTACTGAAACTATCTCTGGTGCGAGCGTTACTTTTACGGGTACGGCGTCCGCTCAATATCCGGAGTTATTGGCAGTATCAGATACAGGTAATGGTACGCTGTTAGCCGGAGGTATTGCCATTGAGATTTTAGATGGCGAGAATGAAAAACCAATCGCCCTTAATATTCTCACCCGACTAAAACCAATAATAAGAGGTGAGAATACATTGAAATATCTTCTGCGTTATAAATCTATCAATAATACAGTAACTGCCGGTGATGCCTCTGCCATTATGTATTTTGATATTATATATCAGTAAGGGGAGTAGTATGCGTTATTTATACCTTTTATTTATGTTAATGGTGATGT