Homologs in group_77

Help

12 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20045 FBDBKF_20045 27.6 Morganella morganii S1 sfmF fimbria assembly protein
EHELCC_03485 EHELCC_03485 27.6 Morganella morganii S2 sfmF fimbria assembly protein
NLDBIP_03485 NLDBIP_03485 27.6 Morganella morganii S4 sfmF fimbria assembly protein
LHKJJB_09315 LHKJJB_09315 27.6 Morganella morganii S3 sfmF fimbria assembly protein
HKOGLL_09660 HKOGLL_09660 27.6 Morganella morganii S5 sfmF fimbria assembly protein
F4V73_RS00870 F4V73_RS00870 30.7 Morganella psychrotolerans - fimbrial protein
F4V73_RS01055 F4V73_RS01055 25.8 Morganella psychrotolerans - fimbrial protein
F4V73_RS01060 F4V73_RS01060 21.7 Morganella psychrotolerans - fimbrial protein
F4V73_RS01665 F4V73_RS01665 29.4 Morganella psychrotolerans sfmF fimbria assembly protein
F4V73_RS09370 F4V73_RS09370 24.2 Morganella psychrotolerans - fimbrial protein
F4V73_RS09385 F4V73_RS09385 40.4 Morganella psychrotolerans - fimbrial protein
F4V73_RS10910 F4V73_RS10910 16.9 Morganella psychrotolerans - fimbrial protein

Distribution of the homologs in the orthogroup group_77

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_77

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P11312 6.13e-28 105 40 3 181 3 F17a-A F17 fimbrial protein Escherichia coli
P45988 1.66e-20 87 35 4 184 3 hifA Major fimbrial subunit Haemophilus influenzae
P17835 6.55e-15 72 33 9 186 3 fim3 Serotype 3 fimbrial subunit Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P39264 8.75e-15 71 26 4 156 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P45990 9.47e-15 72 30 6 211 3 hifA Major fimbrial subunit Haemophilus influenzae
P43660 4.99e-14 69 32 7 184 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q03846 7.66e-14 70 30 10 220 3 hifA Major fimbrial subunit Haemophilus influenzae
P45989 2.14e-13 68 32 9 215 3 hifA Major fimbrial subunit Haemophilus influenzae
P14212 2.16e-13 68 32 9 215 1 hifA Major fimbrial subunit Haemophilus influenzae
B2FNJ0 2.43e-13 67 37 6 162 1 smf-1 Major fimbrial subunit SMF-1 Stenotrophomonas maltophilia (strain K279a)
P45992 5.37e-13 67 30 3 175 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P09808 9.35e-13 66 32 7 180 3 fimX Fimbrial protein FimX Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P12730 2.29e-12 65 27 4 184 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P38052 6.82e-12 63 32 5 154 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
Q8X5K5 2.7e-11 62 29 6 183 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P62605 5.3e-11 61 25 3 184 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 5.3e-11 61 25 3 184 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P05788 5.72e-11 62 28 5 179 3 fim2 Serotype 2 fimbrial subunit Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8X582 3.43e-09 56 31 8 186 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
Q08456 5.66e-09 56 25 9 168 5 fimI Putative fimbrin-like protein FimI Salmonella typhi
P22595 1.31e-08 55 29 5 172 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
P45993 1.63e-08 55 37 2 102 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P75855 1.95e-08 54 30 8 186 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
P77789 3.7e-08 53 30 5 175 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
P37920 6.69e-08 53 26 6 184 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P08189 3.45e-07 51 27 5 179 1 fimF Protein FimF Escherichia coli (strain K12)
P42913 3.86e-07 51 35 0 67 2 yraH Uncharacterized fimbrial-like protein YraH Escherichia coli (strain K12)
P12903 4.59e-07 50 28 7 187 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P37926 1.08e-06 49 26 6 178 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q03011 1.58e-06 49 26 8 185 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
Q47223 1.69e-06 49 27 6 187 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P04128 6.71e-06 47 27 4 157 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
P37921 7.95e-06 47 25 9 190 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0ABW5 1.1e-05 47 37 0 62 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 1.1e-05 47 37 0 62 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
P55223 4.83e-05 45 26 7 163 3 None Fimbrial subunit type 1 Salmonella typhimurium
P12266 7.31e-05 44 27 4 157 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P13421 0.000146 43 26 7 188 1 smfA Fimbria A protein Serratia marcescens

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS12590
Feature type CDS
Gene -
Product fimbrial protein
Location 112891 - 113427 (strand: -1)
Length 537 (nucleotides) / 178 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_77
Orthogroup size 13
N. genomes 6

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07345 major type 1 subunit fimbrin (pilin) Shigellosis
Pertussis		 -

Protein Sequence

MKKINVITAIIFAAISSGAVAGDGKITFKGEVVKQSCVVEGSDKNKTVTLPKVSANALQTAGDTTGTTPFTIQLSKCAAAETVTDVGLSFVGPNIDLATKTLNTAGVGTTTAKNVNIALYNQNDQLIKLGMDKDNQNVGFTKLAEGNIQLNYVAKYYALGISEPGLVESNVDFEIIYK

Flanking regions ( +/- flanking 50bp)

TGAATGAATAAGGGTATAAATTCATTATTGAGACGACGAGAATATACTCCATGAAAAAAATTAATGTCATTACCGCTATTATTTTTGCTGCTATTTCTTCCGGTGCTGTAGCGGGTGATGGTAAAATTACGTTTAAAGGTGAAGTGGTAAAACAAAGCTGTGTAGTTGAAGGTTCTGATAAAAATAAAACGGTTACATTACCGAAAGTCAGCGCTAATGCACTGCAAACTGCCGGTGATACAACAGGCACAACACCTTTTACCATTCAATTATCAAAATGTGCCGCAGCAGAAACAGTAACAGATGTTGGTTTAAGTTTTGTCGGCCCGAACATTGACTTAGCCACGAAAACGCTGAATACCGCGGGTGTGGGTACAACAACCGCGAAAAACGTCAATATCGCGTTGTACAACCAGAATGATCAGCTTATTAAACTGGGTATGGATAAAGATAATCAAAATGTTGGTTTTACCAAATTAGCAGAAGGTAATATTCAGTTAAACTATGTTGCCAAGTATTACGCGCTGGGTATTTCTGAGCCCGGTTTAGTAGAATCTAACGTTGATTTCGAAATTATTTATAAATAATATTCATACCCAACGTCATTCAAGATGCAGGAAGGCGGCAAGGGAAGATA