Homologs in group_144

Help

9 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09105 FBDBKF_09105 30.7 Morganella morganii S1 fimA Pilin (type 1 fimbrial protein)
EHELCC_10305 EHELCC_10305 30.7 Morganella morganii S2 fimA Pilin (type 1 fimbrial protein)
NLDBIP_10650 NLDBIP_10650 30.7 Morganella morganii S4 fimA Pilin (type 1 fimbrial protein)
LHKJJB_10705 LHKJJB_10705 30.7 Morganella morganii S3 fimA Pilin (type 1 fimbrial protein)
HKOGLL_13765 HKOGLL_13765 30.7 Morganella morganii S5 fimA Pilin (type 1 fimbrial protein)
F4V73_RS00870 F4V73_RS00870 27.1 Morganella psychrotolerans - fimbrial protein
F4V73_RS01055 F4V73_RS01055 23.4 Morganella psychrotolerans - fimbrial protein
F4V73_RS01850 F4V73_RS01850 19.8 Morganella psychrotolerans - fimbrial protein
F4V73_RS10845 F4V73_RS10845 30.7 Morganella psychrotolerans - fimbrial protein

Distribution of the homologs in the orthogroup group_144

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_144

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P11312 8.61e-21 87 36 5 163 3 F17a-A F17 fimbrial protein Escherichia coli
B2FNJ0 1.84e-11 62 37 7 163 1 smf-1 Major fimbrial subunit SMF-1 Stenotrophomonas maltophilia (strain K279a)
P12903 2.71e-11 62 30 5 168 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P12730 1.38e-10 60 28 3 164 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P43660 1.15e-09 58 28 5 186 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X5K5 1.33e-08 55 26 5 190 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
Q03011 3.68e-08 53 39 4 100 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
Q8X582 3.78e-08 53 27 4 185 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
Q47223 4.25e-08 53 32 3 132 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P12266 5.22e-08 53 35 3 132 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P75855 2.48e-07 51 27 4 185 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
P09808 3.94e-07 51 38 1 70 3 fimX Fimbrial protein FimX Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P05788 5.6e-06 48 31 3 109 3 fim2 Serotype 2 fimbrial subunit Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P62605 6.22e-06 47 27 5 184 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 6.22e-06 47 27 5 184 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45992 9.95e-06 47 27 7 195 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
Q03846 1.94e-05 47 25 10 221 3 hifA Major fimbrial subunit Haemophilus influenzae
P39264 2.65e-05 46 34 1 73 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P39834 3.05e-05 45 36 3 86 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
P17835 3.59e-05 45 33 1 69 3 fim3 Serotype 3 fimbrial subunit Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0ABW5 7.81e-05 44 35 0 60 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 7.81e-05 44 35 0 60 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
P04128 0.000104 44 33 3 106 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
P22595 0.000106 44 34 2 82 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
P13421 0.00015 43 36 3 85 1 smfA Fimbria A protein Serratia marcescens
P45988 0.000304 43 23 6 218 3 hifA Major fimbrial subunit Haemophilus influenzae
P21413 0.000397 42 29 2 99 3 fasA Fimbrial protein 987P Escherichia coli
P45993 0.000508 42 35 5 100 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P12267 0.000672 42 28 6 140 3 mrkA Fimbrial subunit type 3 Klebsiella pneumoniae
P37926 0.000897 41 35 0 53 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS09385
Feature type CDS
Gene -
Product fimbrial protein
Location 1975823 - 1976380 (strand: -1)
Length 558 (nucleotides) / 185 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_144
Orthogroup size 10
N. genomes 6

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07345 major type 1 subunit fimbrin (pilin) Shigellosis
Pertussis
-

Protein Sequence

MNKIKLALLVTGALFAGSNAFAAADATAVERGTVKFIGELTDETCSIVAGDENQTVTLPKLSTNIIGKAGDKGGWTRFTIKVEKCSDTVKEVAAHFEGNGFGSVDQTTGFLLNQSATGSQNVRIAIRNKVGATKDDDMIQIGGTGQYFKTADKKAVLAYEGGYYAVGATTPGPVTATTMYTLAYK

Flanking regions ( +/- flanking 50bp)

TTTTACATAAAAGCAATGAAGTGAGTTAATCATATATTAAGGATATAGATATGAACAAAATTAAGTTAGCATTATTAGTAACAGGTGCACTGTTTGCTGGTTCTAACGCATTTGCGGCAGCAGATGCTACCGCTGTTGAAAGAGGTACTGTTAAATTCATTGGTGAATTAACTGATGAGACTTGTAGTATTGTTGCAGGTGATGAAAATCAAACTGTTACTTTACCAAAACTGTCTACTAATATCATCGGTAAAGCCGGCGATAAAGGTGGTTGGACTCGTTTCACCATTAAGGTGGAAAAATGTTCTGATACCGTTAAAGAAGTTGCTGCACACTTCGAAGGTAATGGATTTGGTTCTGTTGACCAGACTACCGGTTTCCTGCTGAATCAAAGTGCTACCGGTTCTCAGAACGTCCGGATTGCTATCCGTAACAAAGTCGGTGCAACTAAAGATGATGATATGATTCAAATTGGTGGTACAGGCCAGTATTTCAAGACTGCTGACAAGAAAGCGGTATTAGCCTATGAAGGTGGTTACTACGCGGTTGGTGCTACTACCCCGGGTCCTGTTACAGCAACAACAATGTATACTTTAGCTTATAAATAATAATATTCACTAGCTATATATCATAGAGCTACATCTGTAGCTCTATATTT