Homologs in group_387

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20045 FBDBKF_20045 76.8 Morganella morganii S1 sfmF fimbria assembly protein
EHELCC_03485 EHELCC_03485 76.8 Morganella morganii S2 sfmF fimbria assembly protein
NLDBIP_03485 NLDBIP_03485 76.8 Morganella morganii S4 sfmF fimbria assembly protein
LHKJJB_09315 LHKJJB_09315 76.8 Morganella morganii S3 sfmF fimbria assembly protein
HKOGLL_09660 HKOGLL_09660 76.8 Morganella morganii S5 sfmF fimbria assembly protein
F4V73_RS09370 F4V73_RS09370 23.5 Morganella psychrotolerans - fimbrial protein
F4V73_RS12590 F4V73_RS12590 33.7 Morganella psychrotolerans - fimbrial protein

Distribution of the homologs in the orthogroup group_387

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_387

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37926 2.51e-42 142 44 3 173 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P38052 4.8e-36 126 42 4 171 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
P43660 1.45e-20 86 30 3 181 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37920 1.53e-20 86 36 5 152 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P37921 2.84e-20 86 34 4 152 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P55223 4.17e-20 85 34 4 152 3 None Fimbrial subunit type 1 Salmonella typhimurium
P39264 6.15e-18 80 30 3 176 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P62605 3.35e-17 78 34 3 149 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 3.35e-17 78 34 3 149 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X5K5 1.6e-16 76 28 4 181 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P0ABW5 2.01e-16 75 33 3 151 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 2.01e-16 75 33 3 151 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
P12730 3.23e-16 75 31 5 151 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P77789 2.69e-13 67 28 2 150 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
P08189 8.55e-11 60 30 2 139 1 fimF Protein FimF Escherichia coli (strain K12)
P12903 2.24e-10 60 30 6 180 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P22595 5.79e-09 56 27 3 155 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
Q47223 9.3e-09 55 33 6 152 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P04128 2.1e-08 54 33 6 152 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
P12266 3.28e-08 53 33 6 152 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P13429 3.69e-08 53 24 6 181 1 sfaG S-fimbrial protein subunit SfaG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P75860 3.82e-08 53 29 4 151 2 ycbV Uncharacterized fimbrial-like protein YcbV Escherichia coli (strain K12)
Q03011 1.33e-07 52 29 8 182 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
Q8X5L0 7.05e-07 50 28 4 149 2 lpfE Probable fimbrial subunit LpfE Escherichia coli O157:H7
P77294 1.57e-06 49 25 5 178 3 ydeR Uncharacterized fimbrial-like protein YdeR Escherichia coli (strain K12)
P37922 1.78e-06 49 26 6 167 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q08456 1.89e-06 49 26 6 167 5 fimI Putative fimbrin-like protein FimI Salmonella typhi
P45992 9.88e-06 47 28 8 165 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P43664 4.95e-05 45 21 5 180 3 lpfE Protein LpfE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P21413 0.00015 43 27 3 108 3 fasA Fimbrial protein 987P Escherichia coli
P45988 0.000231 43 26 6 164 3 hifA Major fimbrial subunit Haemophilus influenzae
P53521 0.000341 42 24 7 174 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01665
Feature type CDS
Gene sfmF
Product fimbria assembly protein
Location 365311 - 365844 (strand: -1)
Length 534 (nucleotides) / 177 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_387
Orthogroup size 8
N. genomes 6

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07355 fimbrial-like protein - -

Protein Sequence

MKKILNPVLLIIASGLLSPHFATAYELGRVNLQLSGEIVAYTCGVEVSQANKKVDLGRWPLKNLKATGDRTQSMPFGFQLQNCPPSSSVTMVFSGKKDKEDNTLLALTEGAAAAKSVAVEILDNQRKRLPLDTKSPKIAMDINGNGQAQFYANYIATGSQPTPGIADADATFMITYE

Flanking regions ( +/- flanking 50bp)

AGATTTCAATCCCGTGGTTATTTACGCGTTGACTATCAATAGGCCGGAAGATGAAAAAAATATTAAATCCGGTGTTACTGATAATCGCATCCGGATTACTTAGCCCACATTTTGCAACCGCTTATGAACTCGGCAGAGTGAACCTTCAGTTATCCGGTGAAATTGTGGCTTATACCTGCGGTGTGGAAGTTTCTCAGGCAAATAAAAAAGTCGATTTGGGTCGCTGGCCACTGAAAAACCTGAAAGCAACAGGCGACAGAACGCAATCGATGCCATTTGGTTTTCAGCTGCAAAATTGCCCGCCCTCCTCTTCCGTTACTATGGTCTTCAGCGGAAAGAAAGATAAGGAGGATAATACATTGCTGGCACTCACAGAGGGAGCCGCTGCTGCAAAATCAGTGGCAGTTGAAATACTGGACAATCAGAGAAAACGTCTGCCGCTTGATACCAAAAGCCCGAAAATTGCTATGGATATTAACGGAAACGGACAGGCTCAGTTCTATGCAAACTATATTGCCACTGGCAGTCAACCGACACCCGGTATCGCAGATGCTGATGCTACCTTTATGATTACTTACGAGTAATCACTCGTTCCGGCTTTTCCCGTCAGCGCTGTTTGCTCAACAACTGACGG