Homologs in group_3698

Help

3 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS05775 PMI_RS05775 20.2 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS10890 PMI_RS10890 26.8 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS10895 PMI_RS10895 33.1 Proteus mirabilis HI4320 - fimbrial protein

Distribution of the homologs in the orthogroup group_3698

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3698

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P08190 3.49e-58 182 55 0 145 1 fimG Protein FimG Escherichia coli (strain K12)
P77294 2.05e-49 159 46 1 162 3 ydeR Uncharacterized fimbrial-like protein YdeR Escherichia coli (strain K12)
P13430 1.68e-22 91 36 6 165 1 sfaS S-fimbrial adhesin protein SfaS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P77789 8.8e-08 52 30 7 182 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
P75859 0.00058 42 25 1 88 2 ycbU Uncharacterized fimbrial-like protein YcbU Escherichia coli (strain K12)
P04127 0.001 41 28 5 118 1 papA Pap fimbrial major pilin protein Escherichia coli

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17140
Feature type CDS
Gene -
Product fimbrial protein
Location 3770976 - 3771488 (strand: 1)
Length 513 (nucleotides) / 170 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3698
Orthogroup size 4
N. genomes 1

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07349 minor fimbrial subunit - -

Protein Sequence

MMKYKWRGVKNVIFAILCCNTSFAMAADATITVNGSVIARPCETITKTANVDMGDLYTFDFMTPGSTSKWYPVDLELRNCPIGTTSIEATFTGLDDSTGYYRNQGSAKNLHLELQDTAGNKLRNGSKKVVEVGEYSFAAIFPLRVRAISVNGRPTQGSVQAIINVTYVFM

Flanking regions ( +/- flanking 50bp)

AAGCCAGTGCCACTTTTACACTCGAGTACCAATAGAGATAAAGAGAATCAATGATGAAATATAAATGGCGAGGAGTAAAAAACGTAATATTTGCTATTTTATGCTGCAATACTTCATTCGCTATGGCTGCAGATGCAACAATTACTGTTAATGGAAGTGTAATAGCAAGGCCTTGTGAAACAATCACAAAAACAGCCAATGTGGACATGGGCGACCTATATACATTCGATTTTATGACCCCTGGCTCTACCTCTAAATGGTATCCCGTTGATTTGGAGTTAAGAAATTGTCCTATTGGTACAACTTCTATTGAAGCGACATTCACCGGTCTTGATGATAGTACTGGATACTATAGAAATCAGGGCTCAGCTAAAAATCTTCATTTAGAATTACAAGATACTGCAGGTAATAAATTAAGAAACGGTTCAAAAAAAGTGGTTGAAGTTGGTGAGTATTCGTTTGCCGCAATCTTTCCTTTACGAGTAAGAGCCATCTCTGTAAATGGTAGACCTACACAGGGATCAGTACAGGCAATAATTAATGTTACCTATGTATTTATGTAATTGTTATTTAATTAAATTATAGAAAAAACATTATGATAAGCTATAAAAAA