Homologs in group_2816

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09470 FBDBKF_09470 100.0 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_09940 EHELCC_09940 100.0 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_11070 LHKJJB_11070 100.0 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_14130 HKOGLL_14130 100.0 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
F4V73_RS10510 F4V73_RS10510 93.6 Morganella psychrotolerans - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_2816

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2816

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_10285
Feature type CDS
Gene hipB
Product Transcriptional regulator, contains XRE-family HTH domain
Location 2960 - 3268 (strand: 1)
Length 309 (nucleotides) / 102 (amino acids)

Contig

Accession ZDB_525
Length 191527 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2816
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MIKNIHPISSVIGQALKNKRRQLGLSGIELSKILSISQQQISRYERGVNCFNLDMLMRYFAALQMTPNDVNNLFSVLGSYYHHKVGEHEGRIEQSYYNDYGK

Flanking regions ( +/- flanking 50bp)

TATTTATAATAAATAGTAGTCAGAGTGTAATGTAGTCGTCAGGAGGATTTGTGATTAAAAATATTCATCCTATTTCCAGCGTAATAGGCCAGGCTCTTAAAAATAAACGCCGACAGCTCGGGTTATCCGGTATTGAACTTTCAAAAATCTTAAGTATCAGTCAGCAACAGATCTCCCGTTATGAAAGAGGCGTGAATTGTTTTAACCTGGATATGCTTATGCGCTATTTTGCTGCTCTTCAAATGACACCAAACGATGTTAATAATTTATTTTCGGTATTAGGAAGCTATTACCATCATAAGGTCGGAGAGCATGAAGGAAGAATAGAACAATCGTACTATAATGATTACGGAAAATGATTTAAACAATAATAAAGTATATTTATACAGAAATAATGCATAAAACCATT