Homologs in group_1

Help

27 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09470 FBDBKF_09470 100.0 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
FBDBKF_09495 FBDBKF_09495 38.5 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
FBDBKF_20005 FBDBKF_20005 41.8 Morganella morganii S1 - HTH cro/C1-type domain-containing protein
FBDBKF_20070 FBDBKF_20070 39.2 Morganella morganii S1 - HTH cro/C1-type domain-containing protein
EHELCC_03460 EHELCC_03460 39.2 Morganella morganii S2 - HTH cro/C1-type domain-containing protein
EHELCC_03525 EHELCC_03525 41.8 Morganella morganii S2 - HTH cro/C1-type domain-containing protein
EHELCC_09915 EHELCC_09915 38.5 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_09940 EHELCC_09940 100.0 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_03460 NLDBIP_03460 39.2 Morganella morganii S4 - HTH cro/C1-type domain-containing protein
NLDBIP_03525 NLDBIP_03525 41.8 Morganella morganii S4 - HTH cro/C1-type domain-containing protein
NLDBIP_10285 NLDBIP_10285 100.0 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_19235 NLDBIP_19235 38.5 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_09290 LHKJJB_09290 39.2 Morganella morganii S3 - HTH cro/C1-type domain-containing protein
LHKJJB_09355 LHKJJB_09355 41.8 Morganella morganii S3 - HTH cro/C1-type domain-containing protein
LHKJJB_11070 LHKJJB_11070 100.0 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_19135 LHKJJB_19135 38.5 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_09620 HKOGLL_09620 41.8 Morganella morganii S5 - HTH cro/C1-type domain-containing protein
HKOGLL_09685 HKOGLL_09685 39.2 Morganella morganii S5 - HTH cro/C1-type domain-containing protein
HKOGLL_18915 HKOGLL_18915 38.5 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
F4V73_RS01690 F4V73_RS01690 39.2 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS08420 F4V73_RS08420 30.0 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS10485 F4V73_RS10485 41.7 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS10510 F4V73_RS10510 93.6 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS19140 F4V73_RS19140 42.9 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
PMI_RS05155 PMI_RS05155 35.1 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator
PMI_RS10960 PMI_RS10960 25.6 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator
PMI_RS14845 PMI_RS14845 29.5 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_1

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_14130
Feature type CDS
Gene hipB
Product Transcriptional regulator, contains XRE-family HTH domain
Location 121561 - 121869 (strand: -1)
Length 309 (nucleotides) / 102 (amino acids)
In genomic island -

Contig

Accession ZDB_692
Length 124746 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1
Orthogroup size 28
N. genomes 7

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MIKNIHPISSVIGQALKNKRRQLGLSGIELSKILSISQQQISRYERGVNCFNLDMLMRYFAALQMTPNDVNNLFSVLGSYYHHKVGEHEGRIEQSYYNDYGK

Flanking regions ( +/- flanking 50bp)

TATTTATAATAAATAGTAGTCAGAGTGTAATGTAGTCGTCAGGAGGATTTGTGATTAAAAATATTCATCCTATTTCCAGCGTAATAGGCCAGGCTCTTAAAAATAAACGCCGACAGCTCGGGTTATCCGGTATTGAACTTTCAAAAATCTTAAGTATCAGTCAGCAACAGATCTCCCGTTATGAAAGAGGCGTGAATTGTTTTAACCTGGATATGCTTATGCGCTATTTTGCTGCTCTTCAAATGACACCAAACGATGTTAATAATTTATTTTCGGTATTAGGAAGCTATTACCATCATAAGGTCGGAGAGCATGAAGGAAGAATAGAACAATCGTACTATAATGATTACGGAAAATGATTTAAACAATAATAAAGTATATTTATACAGAAATAATGCATAAAACCATT