Homologs in group_1473

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09495 FBDBKF_09495 48.0 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_09915 EHELCC_09915 48.0 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_19235 NLDBIP_19235 48.0 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_19135 LHKJJB_19135 48.0 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_18915 HKOGLL_18915 48.0 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
F4V73_RS10485 F4V73_RS10485 48.1 Morganella psychrotolerans - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_1473

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1473

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P15017 0.000216 39 30 0 59 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
P16117 0.00078 38 38 1 60 1 CI Repressor protein CI (Fragment) Enterobacteria phage 434

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS19140
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 5455 - 5697 (strand: 1)
Length 243 (nucleotides) / 80 (amino acids)

Contig

Accession term accessions NZ_VXKB01000012 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 10864 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1473
Orthogroup size 7
N. genomes 6

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MCDINKKLGSFLKNERISNSLSGAELAKKLNISQQQISRYENGKNNISVKFLITYCNALHISPQKLMAHIFLTDETKKYL

Flanking regions ( +/- flanking 50bp)

ATATATTTTCACCAAATAGAATACAGTACCCAATAAAAAGAAGGTCACACATGTGCGATATAAATAAAAAATTAGGCTCATTTCTAAAGAATGAAAGAATTTCAAATTCATTATCAGGAGCAGAATTAGCTAAAAAATTAAATATTAGCCAACAACAAATATCTAGATACGAAAATGGTAAGAATAATATTTCTGTGAAATTTTTAATAACCTACTGTAATGCACTACATATATCACCCCAAAAACTAATGGCACATATTTTTTTAACGGATGAAACAAAAAAATACCTATAATCATATTAGTTTAATACTATCTACACAACCAAAATTTAAATCATAGATGA