Homologs in group_219

Help

8 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20005 FBDBKF_20005 100.0 Morganella morganii S1 - HTH cro/C1-type domain-containing protein
EHELCC_03525 EHELCC_03525 100.0 Morganella morganii S2 - HTH cro/C1-type domain-containing protein
NLDBIP_03525 NLDBIP_03525 100.0 Morganella morganii S4 - HTH cro/C1-type domain-containing protein
LHKJJB_09355 LHKJJB_09355 100.0 Morganella morganii S3 - HTH cro/C1-type domain-containing protein
PMI_RS05155 PMI_RS05155 43.9 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator
PMI_RS07115 PMI_RS07115 31.6 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator
PMI_RS10960 PMI_RS10960 30.8 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator
PMI_RS14845 PMI_RS14845 35.6 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_219

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_219

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_09620
Feature type CDS
Gene -
Product HTH cro/C1-type domain-containing protein
Location 176936 - 177253 (strand: 1)
Length 318 (nucleotides) / 105 (amino acids)

Contig

Accession ZDB_686
Length 191111 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_219
Orthogroup size 9
N. genomes 6

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MQSLDTVRFFVEYDANKYLGALLRLRRKELGISGQELSGMLNISQQQISRYENGLTNFNIVILFRFFSSLGMTSEEVVRIFKELGLFYSDLNMSQYQKLRIKEGS

Flanking regions ( +/- flanking 50bp)

ACAATTAGTATTTATAAAATTTATATTCTGTAAAAGCATAAGGTATATTTATGCAATCACTAGACACTGTGCGATTTTTTGTCGAATATGACGCCAATAAGTATTTGGGAGCCTTGTTACGTCTGAGAAGAAAAGAACTGGGCATAAGTGGTCAGGAATTATCAGGAATGCTGAATATCAGTCAGCAGCAAATATCACGCTATGAGAACGGATTAACTAATTTCAATATCGTTATCCTTTTCCGTTTTTTTTCCTCATTAGGAATGACATCTGAAGAGGTTGTCAGAATCTTTAAAGAACTGGGACTGTTCTATTCTGATTTAAATATGAGTCAATATCAGAAATTAAGAATAAAGGAGGGAAGCTGATAATATTAAAAAACATGGAGTAAATGGGTTTTTTACAGGAAAAACTCACC