Homologs in group_51

Help

13 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_10365 EHELCC_10365 100.0 Morganella morganii S2 - Fimbria A protein
NLDBIP_10710 NLDBIP_10710 100.0 Morganella morganii S4 - Fimbria A protein
LHKJJB_10645 LHKJJB_10645 100.0 Morganella morganii S3 - Fimbria A protein
HKOGLL_13705 HKOGLL_13705 100.0 Morganella morganii S5 - Fimbria A protein
F4V73_RS10925 F4V73_RS10925 94.3 Morganella psychrotolerans - fimbrial protein
PMI_RS01230 PMI_RS01230 74.3 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS01275 PMI_RS01275 92.0 Proteus mirabilis HI4320 mrpA MR/P fimbria major subunit MrpA
PMI_RS01430 PMI_RS01430 32.0 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS01435 PMI_RS01435 23.8 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS01455 PMI_RS01455 23.7 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS09265 PMI_RS09265 29.9 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS10950 PMI_RS10950 24.9 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS10955 PMI_RS10955 34.7 Proteus mirabilis HI4320 - fimbrial protein

Distribution of the homologs in the orthogroup group_51

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_51

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q03011 7.53e-115 326 92 0 175 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P13421 1.05e-51 166 58 5 181 1 smfA Fimbria A protein Serratia marcescens
P04740 2e-26 102 36 6 180 3 KS71A KS71A fimbrillin Escherichia coli
P42184 1.74e-24 96 34 4 164 1 prsA PRS fimbrial major pilin protein (Fragment) Escherichia coli
P04127 5.67e-22 90 34 5 183 1 papA Pap fimbrial major pilin protein Escherichia coli
P62607 5.64e-21 88 34 7 182 3 F7-2 F7-2 fimbrial protein Escherichia coli
P62608 5.64e-21 88 34 7 182 3 F7-2 F7-2 fimbrial protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P39834 1.04e-18 82 32 6 174 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
P53521 1.14e-17 79 30 3 155 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)
P43660 4.84e-17 77 34 4 150 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X5K5 1.11e-16 76 34 4 141 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P62605 1.35e-16 76 33 5 177 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 1.35e-16 76 33 5 177 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q04681 4.38e-15 72 29 5 185 1 pmfA Major fimbrial subunit Proteus mirabilis (strain HI4320)
P12730 4.73e-15 72 34 4 153 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P42191 1.23e-13 68 34 8 161 1 prsK Protein PrsK Escherichia coli
P62532 3.95e-13 67 33 8 159 1 papK Fimbrial adapter PapK Escherichia coli
P62533 3.95e-13 67 33 8 159 3 papK Fimbrial adapter PapK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P77288 2.98e-11 62 32 4 182 2 yfcV Uncharacterized fimbrial-like protein YfcV Escherichia coli (strain K12)
Q47223 4.21e-11 62 32 5 186 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P55223 2.04e-10 60 31 5 154 3 None Fimbrial subunit type 1 Salmonella typhimurium
P37920 2.45e-10 59 33 6 171 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P12266 3.2e-10 59 33 4 154 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P37921 5.64e-10 58 30 6 182 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P04128 7.04e-10 58 31 4 154 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
P22595 2.06e-09 57 37 4 116 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
P37909 2.07e-09 57 26 5 194 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
P12903 3.33e-09 56 31 6 186 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P11312 6.82e-09 55 31 6 159 3 F17a-A F17 fimbrial protein Escherichia coli
P39264 4.54e-08 53 30 5 152 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P75860 2.45e-07 51 30 4 152 2 ycbV Uncharacterized fimbrial-like protein YcbV Escherichia coli (strain K12)
P21413 9.04e-07 50 28 4 150 3 fasA Fimbrial protein 987P Escherichia coli
P0ABW5 1.16e-06 49 28 6 171 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 1.16e-06 49 28 6 171 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
P76499 1.3e-06 49 28 4 149 2 yfcP Uncharacterized fimbrial-like protein YfcP Escherichia coli (strain K12)
P38052 2.41e-05 45 26 4 147 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
P77789 9.2e-05 44 28 6 161 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
Q03846 0.0002 43 33 2 75 3 hifA Major fimbrial subunit Haemophilus influenzae
P37926 0.000221 43 27 6 154 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P42185 0.00048 42 22 5 174 3 prsH PRS fimbrial minor pilin protein Escherichia coli
Q8X582 0.001 41 26 7 180 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_09045
Feature type CDS
Gene -
Product Fimbria A protein
Location 23915 - 24442 (strand: -1)
Length 528 (nucleotides) / 175 (amino acids)

Contig

Accession contig_10
Length 146103 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_51
Orthogroup size 14
N. genomes 7

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07345 major type 1 subunit fimbrin (pilin) Shigellosis
Pertussis
-

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG042621 MR/P fimbria major subunit MrpA VF1233 Adherence

Protein Sequence

MTLNKLALVLGFGMSVVAGAASAAAQGHGTVKFTGSIIDAPCSITPDTENQTVPLGQISTAALKDGGRSNSRDFKIALENCTTETYKTVQTTFTGSEAADILAGSLGIEGIAKNAAVVITDAGGKQIKLGTPSAAQALRDGNNDLNFAAYLQGSAAEAAVPGDFTAIATFALTYQ

Flanking regions ( +/- flanking 50bp)

ACCGCGTTATTTTTAATATCAAAAAAGCAGAATGTAATATAGGAAATAACATGACTTTGAATAAATTAGCATTAGTGCTGGGCTTTGGTATGTCTGTGGTTGCAGGTGCGGCATCTGCTGCTGCTCAGGGACACGGTACTGTTAAATTCACCGGTTCAATTATTGACGCACCTTGCTCTATTACGCCTGATACCGAAAACCAGACTGTTCCGTTAGGCCAGATCTCCACTGCCGCACTGAAAGACGGCGGCCGCAGTAATTCCCGTGATTTTAAAATCGCATTAGAGAATTGCACCACAGAAACCTACAAAACGGTACAGACCACTTTCACCGGTTCTGAGGCGGCTGATATTCTGGCCGGTTCCCTGGGTATTGAGGGGATTGCCAAAAACGCGGCGGTTGTTATTACTGATGCGGGCGGCAAACAGATCAAATTAGGCACACCAAGCGCGGCGCAGGCTCTGCGTGACGGTAATAACGACCTGAACTTCGCAGCGTATTTACAGGGTTCTGCTGCTGAAGCCGCTGTTCCGGGTGACTTCACCGCTATCGCAACATTCGCACTGACTTATCAGTAATTAATGCCGGTACGGCTCAGGGATGAACCGTGCCGCTTTTCAGTTGCGTG