Homologs in group_65

Help

12 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09045 FBDBKF_09045 74.3 Morganella morganii S1 - Fimbria A protein
EHELCC_10365 EHELCC_10365 74.3 Morganella morganii S2 - Fimbria A protein
NLDBIP_10710 NLDBIP_10710 74.3 Morganella morganii S4 - Fimbria A protein
LHKJJB_10645 LHKJJB_10645 74.3 Morganella morganii S3 - Fimbria A protein
HKOGLL_13705 HKOGLL_13705 74.3 Morganella morganii S5 - Fimbria A protein
F4V73_RS10925 F4V73_RS10925 74.3 Morganella psychrotolerans - fimbrial protein
PMI_RS01275 PMI_RS01275 78.9 Proteus mirabilis HI4320 mrpA MR/P fimbria major subunit MrpA
PMI_RS01430 PMI_RS01430 29.6 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS01435 PMI_RS01435 19.8 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS01455 PMI_RS01455 22.0 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS09265 PMI_RS09265 27.6 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS10955 PMI_RS10955 35.3 Proteus mirabilis HI4320 - fimbrial protein

Distribution of the homologs in the orthogroup group_65

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_65

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q03011 6.97e-98 283 78 0 175 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P13421 3.2e-51 165 56 5 181 1 smfA Fimbria A protein Serratia marcescens
P42184 3.73e-24 95 37 4 164 1 prsA PRS fimbrial major pilin protein (Fragment) Escherichia coli
P04740 4.03e-24 96 35 5 177 3 KS71A KS71A fimbrillin Escherichia coli
P62607 5.23e-21 88 34 7 184 3 F7-2 F7-2 fimbrial protein Escherichia coli
P62608 5.23e-21 88 34 7 184 3 F7-2 F7-2 fimbrial protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P04127 2.87e-19 83 36 5 163 1 papA Pap fimbrial major pilin protein Escherichia coli
P39834 1.88e-18 81 33 6 174 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
P43660 1.52e-15 73 39 2 99 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X5K5 1.69e-15 73 33 7 179 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P12730 2.71e-15 72 32 6 185 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P62605 7.84e-15 71 32 5 182 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 7.84e-15 71 32 5 182 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q47223 1.22e-14 71 33 6 187 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P53521 2.82e-12 65 29 3 155 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)
P12903 8.2e-12 63 31 6 186 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P42191 1.69e-11 62 29 7 168 1 prsK Protein PrsK Escherichia coli
Q04681 9.5e-11 60 26 5 188 1 pmfA Major fimbrial subunit Proteus mirabilis (strain HI4320)
P12266 1.72e-10 60 34 6 155 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P39264 3.02e-10 59 30 6 181 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P62532 3.36e-10 59 28 7 168 1 papK Fimbrial adapter PapK Escherichia coli
P62533 3.36e-10 59 28 7 168 3 papK Fimbrial adapter PapK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P37909 5.16e-10 58 26 5 173 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
P11312 1.09e-09 58 29 7 185 3 F17a-A F17 fimbrial protein Escherichia coli
P21413 1.28e-09 58 34 2 99 3 fasA Fimbrial protein 987P Escherichia coli
P04128 1.75e-09 57 31 4 154 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
P77288 2.86e-09 57 26 7 204 2 yfcV Uncharacterized fimbrial-like protein YfcV Escherichia coli (strain K12)
P76499 3.39e-09 56 31 7 174 2 yfcP Uncharacterized fimbrial-like protein YfcP Escherichia coli (strain K12)
P37921 4.31e-08 53 27 7 188 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37920 5.31e-08 53 28 7 188 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P55223 4.73e-07 50 27 5 155 3 None Fimbrial subunit type 1 Salmonella typhimurium
P38052 1e-06 49 25 5 163 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
P0ABW5 5.48e-06 47 28 7 189 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 5.48e-06 47 28 7 189 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
P22595 1.41e-05 46 31 4 129 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
P37926 4.79e-05 45 26 6 178 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P42185 0.00048 42 21 5 174 3 prsH PRS fimbrial minor pilin protein Escherichia coli
P25394 0.000514 42 25 9 185 3 fedA F107 fimbrial protein Escherichia coli
P13430 0.000717 41 25 7 184 1 sfaS S-fimbrial adhesin protein SfaS Escherichia coli O6:K15:H31 (strain 536 / UPEC)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01230
Feature type CDS
Gene -
Product fimbrial protein
Location 302482 - 303009 (strand: 1)
Length 528 (nucleotides) / 175 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_65
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07345 major type 1 subunit fimbrin (pilin) Shigellosis
Pertussis
-

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG042621 MR/P fimbria major subunit MrpA VF1233 Adherence

Protein Sequence

MKLKKLHLVLGLGLSIIAGSALAADQGHGTVEFYGSIIDAPCSIDPDSGAQRIPLGQVSSSALKDGGRSASKMFKIKLLQCSTETYKTVKTTFTGAEAPDVLEGALGIEGIAKNAAVVITNAGGEQIKLGQASAAQTLNDGNNDLNFAAYLQGSSSKAAIPGDFTAIATFALSYQ

Flanking regions ( +/- flanking 50bp)

ATGTTGTTGCTTTTATACTTTATTTAACTTTTATATTTTAGGAAAACAAAATGAAATTAAAAAAACTGCATTTAGTTTTAGGGTTAGGCTTATCTATCATTGCGGGCTCTGCATTAGCGGCAGATCAAGGGCATGGTACTGTTGAATTCTATGGTTCAATTATTGATGCTCCTTGTTCTATCGATCCTGATTCAGGTGCTCAACGTATTCCATTAGGTCAAGTGTCATCTAGCGCACTGAAAGACGGTGGCCGTAGTGCATCAAAAATGTTTAAAATCAAATTATTACAGTGTTCTACTGAGACATATAAAACAGTCAAAACAACCTTTACCGGTGCTGAAGCTCCTGATGTTTTAGAGGGGGCTTTAGGTATTGAAGGGATCGCCAAAAATGCAGCTGTTGTTATCACCAATGCAGGTGGTGAACAAATCAAATTAGGTCAAGCAAGTGCCGCCCAAACATTGAATGACGGTAACAATGACTTAAATTTTGCCGCTTATTTACAAGGATCTTCCTCAAAAGCTGCTATTCCTGGTGATTTTACAGCAATAGCCACTTTTGCTTTATCTTATCAATAATAGTCGTCAAATAAAGCTTTGTATAAGGATATACAAGGCTTTGTTAATTG