Homologs in group_51

Help

13 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09045 FBDBKF_09045 29.9 Morganella morganii S1 - Fimbria A protein
EHELCC_10365 EHELCC_10365 29.9 Morganella morganii S2 - Fimbria A protein
NLDBIP_10710 NLDBIP_10710 29.9 Morganella morganii S4 - Fimbria A protein
LHKJJB_10645 LHKJJB_10645 29.9 Morganella morganii S3 - Fimbria A protein
HKOGLL_13705 HKOGLL_13705 29.9 Morganella morganii S5 - Fimbria A protein
F4V73_RS10925 F4V73_RS10925 28.7 Morganella psychrotolerans - fimbrial protein
PMI_RS01230 PMI_RS01230 27.6 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS01275 PMI_RS01275 30.5 Proteus mirabilis HI4320 mrpA MR/P fimbria major subunit MrpA
PMI_RS01430 PMI_RS01430 28.8 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS01435 PMI_RS01435 22.4 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS01455 PMI_RS01455 17.9 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS10950 PMI_RS10950 18.6 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS10955 PMI_RS10955 26.6 Proteus mirabilis HI4320 - fimbrial protein

Distribution of the homologs in the orthogroup group_51

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_51

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q04681 3.39e-130 365 100 0 184 1 pmfA Major fimbrial subunit Proteus mirabilis (strain HI4320)
P13421 2.21e-27 104 36 3 184 1 smfA Fimbria A protein Serratia marcescens
P12730 1.65e-16 76 32 7 190 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P04740 7.88e-16 74 34 8 192 3 KS71A KS71A fimbrillin Escherichia coli
Q03011 2.65e-14 70 28 4 184 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P42184 2.55e-13 67 33 4 156 1 prsA PRS fimbrial major pilin protein (Fragment) Escherichia coli
P53521 1.52e-12 65 26 2 154 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)
Q47223 2.17e-12 65 29 5 166 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P62605 6.57e-12 64 30 6 188 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 6.57e-12 64 30 6 188 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P12266 1.99e-11 62 32 4 131 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P04128 2.32e-11 62 32 3 128 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
Q8X582 3.23e-11 62 29 5 158 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
Q8X5K5 8.04e-11 61 32 6 177 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P04127 1.2e-10 60 29 7 192 1 papA Pap fimbrial major pilin protein Escherichia coli
P62607 1.97e-10 60 32 4 169 3 F7-2 F7-2 fimbrial protein Escherichia coli
P62608 1.97e-10 60 32 4 169 3 F7-2 F7-2 fimbrial protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P75855 4.67e-10 59 28 5 158 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
P37921 2.36e-09 57 29 7 182 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P55223 2.39e-09 57 29 5 164 3 None Fimbrial subunit type 1 Salmonella typhimurium
P12903 4.11e-08 53 26 3 145 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P43660 2.11e-07 52 28 7 185 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P39834 5.22e-07 50 27 6 163 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
P37909 8.95e-06 47 22 3 189 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
P75860 1.66e-05 46 25 4 161 2 ycbV Uncharacterized fimbrial-like protein YcbV Escherichia coli (strain K12)
P42913 0.000109 44 24 4 179 2 yraH Uncharacterized fimbrial-like protein YraH Escherichia coli (strain K12)
P21413 0.000287 43 28 6 170 3 fasA Fimbrial protein 987P Escherichia coli

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09265
Feature type CDS
Gene -
Product fimbrial protein
Location 2024828 - 2025382 (strand: 1)
Length 555 (nucleotides) / 184 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_51
Orthogroup size 14
N. genomes 7

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG042610 fimbrial protein VF1236 Adherence

Protein Sequence

MKLSKIALAAALVFGINSVATAENETPAPKVSSTKGEIQLKGEIVNSACGLAASSSPVIVDFSEIPTSALANLQKAGNIKKDIELQDCDTTVAKTATVSYTPSVVNAVNKDLASFVSGNASGAGIGLMDAGSKAVKWNTATTPVQLINGVSKIPFVAYVQAESADAKVTPGEFQAVINFQVDYQ

Flanking regions ( +/- flanking 50bp)

TTTATTTTTAGTCAATAATAATACGTACTACCTTCAAGGGATCATCTATAATGAAACTGAGTAAAATTGCTTTGGCTGCGGCTTTAGTATTTGGTATTAATTCTGTTGCTACAGCTGAAAATGAAACGCCTGCACCAAAAGTAAGTTCAACTAAAGGCGAAATTCAATTAAAAGGTGAAATTGTTAATTCAGCATGTGGATTAGCAGCATCTTCAAGCCCTGTAATTGTTGATTTCAGTGAAATTCCAACTTCTGCATTAGCAAATCTGCAAAAAGCAGGAAATATCAAAAAAGATATTGAATTACAAGACTGTGATACAACTGTAGCGAAAACTGCCACAGTTAGCTATACACCAAGTGTTGTTAACGCTGTAAATAAAGATTTAGCCTCTTTTGTTTCTGGTAACGCATCTGGCGCAGGTATTGGCTTAATGGATGCAGGTAGTAAAGCAGTTAAATGGAATACTGCAACTACACCAGTACAATTAATTAACGGTGTATCTAAAATCCCATTCGTTGCTTATGTTCAAGCTGAATCAGCTGACGCTAAAGTAACGCCAGGTGAATTCCAAGCCGTTATCAACTTCCAAGTTGATTATCAGTAATCATATTGATTTAAATATCTAAATTAATAAATAAGTAATTACTGCGAAAA