Homologs in group_196

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18920 FBDBKF_18920 44.7 Morganella morganii S1 araC AraC-type DNA-binding domain and AraC-containing proteins
FBDBKF_20455 FBDBKF_20455 58.5 Morganella morganii S1 tetD Transposon Tn10 TetD protein
EHELCC_18665 EHELCC_18665 44.7 Morganella morganii S2 araC AraC-type DNA-binding domain and AraC-containing proteins
NLDBIP_18640 NLDBIP_18640 44.7 Morganella morganii S4 araC AraC-type DNA-binding domain and AraC-containing proteins
LHKJJB_18535 LHKJJB_18535 44.7 Morganella morganii S3 araC AraC-type DNA-binding domain and AraC-containing proteins
HKOGLL_18270 HKOGLL_18270 44.7 Morganella morganii S5 araC AraC-type DNA-binding domain and AraC-containing proteins
F4V73_RS13825 F4V73_RS13825 45.4 Morganella psychrotolerans - helix-turn-helix domain-containing protein

Distribution of the homologs in the orthogroup group_196

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_196

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZJU7 3.74e-59 194 36 3 287 2 rob Transcriptional regulator Rob Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0ACI2 4.81e-58 191 36 1 283 3 rob Right origin-binding protein Shigella flexneri
P0ACI0 4.81e-58 191 36 1 283 1 rob Right origin-binding protein Escherichia coli (strain K12)
P0ACI1 4.81e-58 191 36 1 283 3 rob Right origin-binding protein Escherichia coli O157:H7
P28816 7.7e-47 157 72 0 104 1 tetD Transposon Tn10 TetD protein Escherichia coli
P43463 5.52e-37 131 54 0 117 4 aarP HTH-type transcriptional activator AarP Providencia stuartii
P0ACH7 2.85e-31 116 47 0 114 3 marA Multiple antibiotic resistance protein MarA Shigella flexneri
P0ACH5 2.85e-31 116 47 0 114 1 marA Multiple antibiotic resistance protein MarA Escherichia coli (strain K12)
P0ACH6 2.85e-31 116 47 0 114 3 marA Multiple antibiotic resistance protein MarA Escherichia coli O157:H7
P0A2S4 1.58e-30 114 46 0 114 2 marA Multiple antibiotic resistance protein MarA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2S5 1.58e-30 114 46 0 114 3 marA Multiple antibiotic resistance protein MarA Salmonella typhi
P0A2S6 1.58e-30 114 46 0 114 3 marA Multiple antibiotic resistance protein MarA Salmonella enteritidis
P77601 1.4e-26 107 39 0 141 5 ykgA Putative HTH-type transcriptional regulator YkgA Escherichia coli (strain K12)
Q48413 2.07e-26 103 48 0 105 1 ramA Transcriptional activator RamA Klebsiella pneumoniae
A0A0H3GPK2 2.07e-26 103 48 0 105 1 ramA Transcriptional regulator RamA Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P0A9E2 3.54e-26 102 49 0 100 1 soxS Regulatory protein SoxS Escherichia coli (strain K12)
P0A9E3 3.54e-26 102 49 0 100 3 soxS Regulatory protein SoxS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9E4 3.54e-26 102 49 0 100 3 soxS Regulatory protein SoxS Escherichia coli O157:H7
H9L484 1.18e-25 101 46 0 105 1 ramA Transcriptional regulator RamA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q56143 1.44e-25 101 49 0 100 3 soxS Regulatory protein SoxS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q52620 6.81e-25 99 46 1 102 4 pqrA Probable transcription factor PqrA Proteus vulgaris
P55922 1.25e-24 99 46 0 105 4 ramA Transcriptional activator RamA Enterobacter cloacae
P26950 3.85e-17 83 27 8 297 4 caf1R F1 operon positive regulatory protein Yersinia pestis
O31456 2.98e-13 72 39 0 100 3 ybfP Uncharacterized HTH-type transcriptional regulator YbfP Bacillus subtilis (strain 168)
P96662 2.21e-12 69 34 0 101 4 ydeE Uncharacterized HTH-type transcriptional regulator YdeE Bacillus subtilis (strain 168)
Q65Q30 7.96e-09 58 31 0 102 3 rhaR HTH-type transcriptional activator RhaR Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8ZM00 3.2e-08 57 23 8 283 1 STM3175 Probable HTH-type transcriptional regulator STM3175 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O32071 8.71e-08 57 31 0 92 4 ytdP Uncharacterized HTH-type transcriptional regulator YtdP Bacillus subtilis (strain 168)
Q936F1 1.28e-07 56 27 0 105 4 None Uncharacterized HTH-type transcriptional regulator Staphylococcus aureus
P54722 1.32e-07 55 33 1 101 4 yfiF Uncharacterized HTH-type transcriptional regulator YfiF Bacillus subtilis (strain 168)
Q6GD21 2.78e-07 55 27 0 105 4 SAS0078 Uncharacterized HTH-type transcriptional regulator SAS0078 Staphylococcus aureus (strain MSSA476)
Q8NYT6 2.78e-07 55 27 0 105 4 MW0077 Uncharacterized HTH-type transcriptional regulator MW0077 Staphylococcus aureus (strain MW2)
Q6GKK1 2.8e-07 55 27 0 105 4 SAR0107 Uncharacterized HTH-type transcriptional regulator SAR0107 Staphylococcus aureus (strain MRSA252)
Q99XB1 3.04e-07 55 27 0 105 4 SAV0101 Uncharacterized HTH-type transcriptional regulator SAV0101 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A882 3.04e-07 55 27 0 105 4 SA0097 Uncharacterized HTH-type transcriptional regulator SA0097 Staphylococcus aureus (strain N315)
Q5HJR8 3.41e-07 55 27 0 105 4 SACOL0084 Uncharacterized HTH-type transcriptional regulator SACOL0084 Staphylococcus aureus (strain COL)
Q9HTI4 3.59e-07 54 24 1 140 1 gbdR HTH-type transcriptional regulator GbdR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0A0H2ZIC3 3.59e-07 54 24 1 140 1 gbdR HTH-type transcriptional regulator GbdR Pseudomonas aeruginosa (strain UCBPP-PA14)
G3XCU2 4.76e-07 53 32 1 108 4 argR HTH-type transcriptional regulator ArgR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P77396 6.95e-07 53 32 0 91 4 ypdC Uncharacterized HTH-type transcriptional regulator YpdC Escherichia coli (strain K12)
P11765 1.31e-06 52 34 0 67 3 araC Arabinose operon regulatory protein Citrobacter freundii
P0A9E0 1.33e-06 52 34 0 67 1 araC Arabinose operon regulatory protein Escherichia coli (strain K12)
P0A9E1 1.33e-06 52 34 0 67 3 araC Arabinose operon regulatory protein Escherichia coli O157:H7
P03022 1.5e-06 52 33 0 68 3 araC Arabinose operon regulatory protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q65Q31 1.51e-06 52 28 0 97 3 rhaS HTH-type transcriptional activator RhaS Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
O31449 1.73e-06 52 29 1 100 4 ybfI Uncharacterized HTH-type transcriptional regulator YbfI Bacillus subtilis (strain 168)
Q9HTH5 2.76e-06 51 33 1 103 1 cdhR HTH-type transcriptional regulator CdhR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q00753 4.09e-06 50 27 1 110 4 msmR Msm operon regulatory protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9WW32 4.11e-06 51 32 0 82 1 mtrA HTH-type transcriptional regulator MtrA Neisseria gonorrhoeae
Q83PE0 4.29e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Shigella flexneri
Q0SZ95 4.29e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Shigella flexneri serotype 5b (strain 8401)
Q1R414 4.49e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain UTI89 / UPEC)
B7NFK3 4.49e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A1AI82 4.49e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O1:K1 / APEC
B7NUA1 4.49e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MI37 4.49e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O45:K1 (strain S88 / ExPEC)
Q32A70 4.53e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Shigella dysenteriae serotype 1 (strain Sd197)
Q0TAF8 4.57e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UNM6 4.57e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1LMU6 4.61e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain SMS-3-5 / SECEC)
B7N2P7 4.65e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O81 (strain ED1a)
Q31U84 4.78e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Shigella boydii serotype 4 (strain Sb227)
P09377 4.78e-06 50 33 1 109 1 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12)
B1IVH3 4.78e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8CXW5 4.78e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A709 4.78e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O9:H4 (strain HS)
B1XB72 4.78e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12 / DH10B)
C5A073 4.78e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6V7 4.78e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O8 (strain IAI1)
B7L9G1 4.78e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain 55989 / EAEC)
B5XZ49 4.96e-06 50 31 0 103 3 rhaS HTH-type transcriptional activator RhaS Klebsiella pneumoniae (strain 342)
B6I4P8 5.39e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain SE11)
Q3YV71 5.59e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Shigella sonnei (strain Ss046)
A6TGA9 7.23e-06 50 31 0 103 3 rhaS HTH-type transcriptional activator RhaS Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B2TVP7 8.68e-06 50 33 1 109 3 rhaS HTH-type transcriptional activator RhaS Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A7ZUB7 1.24e-05 49 32 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AL27 1.31e-05 49 30 0 106 3 rhaS HTH-type transcriptional activator RhaS Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q32A71 1.49e-05 49 26 1 113 3 rhaR HTH-type transcriptional activator RhaR Shigella dysenteriae serotype 1 (strain Sd197)
P09378 1.91e-05 48 26 1 113 1 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain K12)
A8A710 1.91e-05 48 26 1 113 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O9:H4 (strain HS)
C5A074 1.91e-05 48 26 1 113 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain K12 / MC4100 / BW2952)
Q1R413 2e-05 48 26 1 113 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain UTI89 / UPEC)
A1AI83 2e-05 48 26 1 113 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O1:K1 / APEC
Q8X7B3 2.05e-05 48 26 1 113 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O157:H7
Q83PD9 2.07e-05 48 26 1 113 3 rhaR HTH-type transcriptional activator RhaR Shigella flexneri
Q0SZ96 2.07e-05 48 26 1 113 3 rhaR HTH-type transcriptional activator RhaR Shigella flexneri serotype 5b (strain 8401)
Q05587 2.11e-05 48 25 1 111 1 pocR Regulatory protein PocR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5YZ43 2.15e-05 48 32 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X897 2.15e-05 48 32 1 109 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O157:H7
Q31U83 2.27e-05 48 25 0 102 3 rhaR HTH-type transcriptional activator RhaR Shigella boydii serotype 4 (strain Sb227)
Q8FBD7 2.27e-05 48 25 0 102 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAF7 2.27e-05 48 25 0 102 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZUB8 2.27e-05 48 25 0 102 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O139:H28 (strain E24377A / ETEC)
B4TPQ9 2.7e-05 48 29 0 106 3 rhaS HTH-type transcriptional activator RhaS Salmonella schwarzengrund (strain CVM19633)
B5BJG8 2.85e-05 48 29 0 106 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi A (strain AKU_12601)
Q5PKG2 2.85e-05 48 29 0 106 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P0ACH8 2.89e-05 48 28 0 110 1 melR Melibiose operon regulatory protein Escherichia coli (strain K12)
P0ACH9 2.89e-05 48 28 0 110 3 melR Melibiose operon regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A4WG91 2.93e-05 48 32 0 103 3 rhaS HTH-type transcriptional activator RhaS Enterobacter sp. (strain 638)
B5FPP5 2.98e-05 48 29 0 106 3 rhaS HTH-type transcriptional activator RhaS Salmonella dublin (strain CT_02021853)
B4TBY3 3.01e-05 48 29 0 106 3 rhaS HTH-type transcriptional activator RhaS Salmonella heidelberg (strain SL476)
P0A2S9 3.04e-05 48 29 0 106 3 rhaS HTH-type transcriptional activator RhaS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2T0 3.04e-05 48 29 0 106 3 rhaS HTH-type transcriptional activator RhaS Salmonella typhi
C0Q3L4 3.04e-05 48 29 0 106 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi C (strain RKS4594)
A9MZC8 3.04e-05 48 29 0 106 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SZZ3 3.04e-05 48 29 0 106 3 rhaS HTH-type transcriptional activator RhaS Salmonella newport (strain SL254)
B5RFC3 3.04e-05 48 29 0 106 3 rhaS HTH-type transcriptional activator RhaS Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QWY4 3.04e-05 48 29 0 106 3 rhaS HTH-type transcriptional activator RhaS Salmonella enteritidis PT4 (strain P125109)
B5F0M9 3.12e-05 48 29 0 106 3 rhaS HTH-type transcriptional activator RhaS Salmonella agona (strain SL483)
P45008 3.33e-05 48 34 0 66 4 HI_1052 Uncharacterized HTH-type transcriptional regulator HI_1052 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q57HG8 3.52e-05 48 30 0 103 3 rhaS HTH-type transcriptional activator RhaS Salmonella choleraesuis (strain SC-B67)
A9MI64 3.61e-05 48 30 0 103 3 rhaS HTH-type transcriptional activator RhaS Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7LVD8 4.03e-05 47 30 0 99 3 rhaS HTH-type transcriptional activator RhaS Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q66FF1 5.78e-05 47 30 0 82 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FN79 5.78e-05 47 30 0 82 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TRS7 5.99e-05 47 30 0 82 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis (strain Pestoides F)
Q1CEB6 5.99e-05 47 30 0 82 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYR6 5.99e-05 47 30 0 82 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIZ9 5.99e-05 47 30 0 82 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis
B2K1W6 5.99e-05 47 30 0 82 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0W2 5.99e-05 47 30 0 82 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Antiqua)
B4TPR0 7.98e-05 47 25 0 101 3 rhaR HTH-type transcriptional activator RhaR Salmonella schwarzengrund (strain CVM19633)
Q47129 9.21e-05 47 33 3 95 1 feaR Transcriptional activator FeaR Escherichia coli (strain K12)
C6DJR5 0.000119 46 28 0 96 3 rhaR HTH-type transcriptional activator RhaR Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B1JNC4 0.000137 46 33 0 68 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7ML57 0.000147 46 35 0 68 3 rhaR HTH-type transcriptional activator RhaR Cronobacter sakazakii (strain ATCC BAA-894)
Q57HG7 0.000148 46 26 0 101 3 rhaR HTH-type transcriptional activator RhaR Salmonella choleraesuis (strain SC-B67)
Q8Z2V5 0.000164 46 26 0 101 3 rhaR HTH-type transcriptional activator RhaR Salmonella typhi
B4TBY4 0.000164 46 26 0 101 3 rhaR HTH-type transcriptional activator RhaR Salmonella heidelberg (strain SL476)
Q6DA21 0.000165 46 27 0 96 3 rhaR HTH-type transcriptional activator RhaR Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P07642 0.000224 45 26 0 99 3 araC Arabinose operon regulatory protein Dickeya chrysanthemi
A9MI63 0.000229 45 25 0 101 3 rhaR HTH-type transcriptional activator RhaR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F0N0 0.000233 45 25 0 101 3 rhaR HTH-type transcriptional activator RhaR Salmonella agona (strain SL483)
P40865 0.000242 45 25 0 101 3 rhaR HTH-type transcriptional activator RhaR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BJG9 0.000242 45 25 0 101 3 rhaR HTH-type transcriptional activator RhaR Salmonella paratyphi A (strain AKU_12601)
A9MZC9 0.000242 45 25 0 101 3 rhaR HTH-type transcriptional activator RhaR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKG1 0.000242 45 25 0 101 3 rhaR HTH-type transcriptional activator RhaR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SZZ4 0.000242 45 25 0 101 3 rhaR HTH-type transcriptional activator RhaR Salmonella newport (strain SL254)
B5QWY5 0.000242 45 25 0 101 3 rhaR HTH-type transcriptional activator RhaR Salmonella enteritidis PT4 (strain P125109)
P19219 0.000256 45 27 0 97 1 adaA Bifunctional transcriptional activator/DNA repair enzyme AdaA Bacillus subtilis (strain 168)
P0ACI3 0.000272 45 27 0 112 1 xylR Xylose operon regulatory protein Escherichia coli (strain K12)
P0ACI4 0.000272 45 27 0 112 3 xylR Xylose operon regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACI5 0.000272 45 27 0 112 3 xylR Xylose operon regulatory protein Escherichia coli O157:H7
P40331 0.000332 45 26 1 111 4 yisR Uncharacterized HTH-type transcriptional regulator YisR Bacillus subtilis (strain 168)
A6TGB0 0.000415 45 26 0 86 3 rhaR HTH-type transcriptional activator RhaR Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P96660 0.000438 44 23 0 101 4 ydeC Uncharacterized HTH-type transcriptional regulator YdeC Bacillus subtilis (strain 168)
A4WG90 0.000532 44 25 0 99 3 rhaR HTH-type transcriptional activator RhaR Enterobacter sp. (strain 638)
Q46855 0.000682 44 27 0 97 4 yqhC Uncharacterized HTH-type transcriptional regulator YqhC Escherichia coli (strain K12)
O33813 0.001 43 27 0 100 4 lacR Lactose operon transcription activator Staphylococcus xylosus

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS19730
Feature type CDS
Gene -
Product helix-turn-helix domain-containing protein
Location 1237353 - 1238267 (strand: -1)
Length 915 (nucleotides) / 304 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_196
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF06445 GyrI-like small molecule binding domain
PF12833 Helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2207 Transcription (K) K AraC-type DNA-binding domain and AraC-containing proteins

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05804 AraC family transcriptional regulator, mar-sox-rob regulon activator - -

Protein Sequence

MSSQFNGLIPSNSLSSFNIEVIKELLLWIEVNLEKPLLLDDVAIKSGYTKWHLQRVFKQATGLTLASYIRGRRLTKAATELRLTKLPVLTIALRYQFDSQQSFTRRFKAVFGVTPSEYRKVDVLCSDNFQPPINFEVTDLPIPNIIELPESFLYVIQYQYFCSIEDIGKLHEDIRHQFWNDFLLYTDKNFTESSVLISYQPNTLRKDKIQIDYEIGLNNLDHFTRPRGFRKKAIAGGRYVRFQFKGTLEEYKQFAIKIYFYTLPALGLCRRLGPDIENYICIETDSDIMELPKTLEIDYYVPIH

Flanking regions ( +/- flanking 50bp)

GGGTATCAGTTTTGTGTAAACTGAACAAAATATCTTTTCAGGAAATCATCATGTCATCTCAGTTCAATGGACTTATCCCTTCCAATTCTTTATCTTCGTTTAATATAGAAGTGATTAAAGAACTTCTGCTCTGGATCGAGGTAAATCTAGAAAAGCCGTTATTACTTGATGATGTTGCGATAAAATCAGGTTATACAAAATGGCATTTACAACGGGTGTTTAAGCAAGCAACGGGCTTAACATTAGCCTCTTATATTCGTGGTAGACGACTGACCAAAGCCGCCACTGAATTGCGCTTAACTAAACTTCCGGTATTAACTATCGCACTACGCTATCAATTTGATTCGCAGCAATCTTTTACACGCCGCTTTAAAGCTGTTTTTGGCGTTACTCCTTCGGAATACCGTAAAGTTGATGTGTTGTGTAGCGACAATTTTCAGCCCCCCATCAATTTTGAAGTTACCGACCTCCCTATTCCAAATATTATCGAGCTACCTGAAAGCTTTCTTTATGTTATTCAATACCAATACTTTTGCTCTATCGAGGATATTGGCAAGCTACATGAAGATATTCGTCATCAGTTTTGGAATGATTTTCTGTTGTACACAGATAAAAACTTTACGGAAAGTAGTGTGTTAATTTCTTATCAGCCAAATACATTACGTAAAGATAAGATCCAGATTGATTATGAAATTGGCCTAAACAATTTAGATCACTTTACCAGACCCCGTGGTTTTAGAAAAAAAGCGATTGCAGGCGGGCGTTATGTTCGTTTCCAATTTAAAGGCACGTTAGAAGAATATAAACAATTTGCCATCAAGATCTACTTTTATACTTTACCGGCTTTGGGGTTATGTCGTCGTTTAGGGCCAGATATTGAAAACTACATTTGTATAGAAACAGATAGCGACATTATGGAACTACCAAAAACACTGGAAATTGATTATTACGTTCCAATTCATTAATCAGTAATAAGTACTTAACGACTTGACTTTCAGTTTATTGATATGGCTAA