Homologs in group_258

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06280 FBDBKF_06280 82.0 Morganella morganii S1 folA type 3 dihydrofolate reductase
EHELCC_09325 EHELCC_09325 82.0 Morganella morganii S2 folA type 3 dihydrofolate reductase
NLDBIP_09705 NLDBIP_09705 82.0 Morganella morganii S4 folA type 3 dihydrofolate reductase
LHKJJB_08050 LHKJJB_08050 82.0 Morganella morganii S3 folA type 3 dihydrofolate reductase
HKOGLL_07600 HKOGLL_07600 82.0 Morganella morganii S5 folA type 3 dihydrofolate reductase
F4V73_RS15640 F4V73_RS15640 80.1 Morganella psychrotolerans folA type 3 dihydrofolate reductase
F4V73_RS17885 F4V73_RS17885 35.1 Morganella psychrotolerans - dihydrofolate reductase

Distribution of the homologs in the orthogroup group_258

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_258

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P31074 1.85e-89 260 75 0 158 3 folA Dihydrofolate reductase Klebsiella aerogenes
P0ABQ6 3.42e-89 259 76 0 158 3 folA Dihydrofolate reductase Shigella flexneri
P0ABQ4 3.42e-89 259 76 0 158 1 folA Dihydrofolate reductase Escherichia coli (strain K12)
P0ABQ5 3.42e-89 259 76 0 158 3 folA Dihydrofolate reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P31073 3.5e-88 257 75 0 158 3 folA Dihydrofolate reductase Citrobacter freundii
P43791 4.27e-56 176 52 0 160 3 folA Dihydrofolate reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K9Z8 2.1e-52 167 50 2 161 3 folA Dihydrofolate reductase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57243 7.96e-52 165 48 2 161 3 folA Dihydrofolate reductase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AV2 3.55e-47 154 46 2 162 3 folA Dihydrofolate reductase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P12833 9.92e-46 150 48 1 162 1 dhfrIII Dihydrofolate reductase type 3 Salmonella typhimurium
P11045 2.16e-39 134 41 1 159 1 dfrA Dihydrofolate reductase Bacillus subtilis (strain 168)
Q5V600 2.9e-34 120 48 3 141 3 folA2 Dihydrofolate reductase 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q54277 1.56e-32 116 36 1 160 1 dfrD Dihydrofolate reductase Staphylococcus haemolyticus
P04174 7.58e-30 109 42 2 136 1 folA Dihydrofolate reductase Neisseria gonorrhoeae
P0A017 3.62e-29 107 35 2 162 1 folA Dihydrofolate reductase Staphylococcus aureus
Q6GGY1 3.62e-29 107 35 2 162 3 folA Dihydrofolate reductase Staphylococcus aureus (strain MRSA252)
P99079 3.62e-29 107 35 2 162 1 folA Dihydrofolate reductase Staphylococcus aureus (strain N315)
P0A016 3.62e-29 107 35 2 162 3 folA Dihydrofolate reductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFZ7 3.62e-29 107 35 2 162 3 folA Dihydrofolate reductase Staphylococcus aureus (strain COL)
Q9UWQ4 1.04e-28 107 38 4 168 1 hdrB Dihydrofolate reductase HdrB Haloferax volcanii
P0C0P1 1.23e-28 106 35 2 162 3 folA Dihydrofolate reductase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPB1 1.23e-28 106 35 2 162 3 folA Dihydrofolate reductase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0C0P0 1.23e-28 106 35 2 162 1 folA Dihydrofolate reductase Staphylococcus epidermidis
Q8NWQ9 1.6e-28 106 34 1 161 3 folA Dihydrofolate reductase Staphylococcus aureus (strain MW2)
Q6G9D5 1.6e-28 106 34 1 161 3 folA Dihydrofolate reductase Staphylococcus aureus (strain MSSA476)
P13955 2.41e-28 105 35 2 162 1 dfrA Dihydrofolate reductase type 1 from Tn4003 Staphylococcus aureus
P11731 1.74e-27 103 37 5 162 1 dhfrV Dihydrofolate reductase type 5 Escherichia coli
Q54801 1.43e-26 101 34 7 173 1 dhfR Dihydrofolate reductase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q59408 4.02e-26 100 35 1 153 3 dfrA13 Dihydrofolate reductase type A13 Escherichia coli
Q9K168 7.27e-26 99 42 2 136 3 folA Dihydrofolate reductase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JSQ9 8.18e-26 99 42 2 136 3 folA Dihydrofolate reductase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P78218 1.95e-21 87 33 4 162 3 dhfrXV Dihydrofolate reductase type 15 Escherichia coli
P15093 7.43e-21 86 33 3 148 1 hdrA Dihydrofolate reductase HdrA Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P95524 5.8e-20 84 33 5 159 3 dhfrVI Dihydrofolate reductase type 6 Proteus mirabilis
P27422 8e-20 83 32 5 162 3 dhfrVII Dihydrofolate reductase type 7 Escherichia coli
Q9CBW1 1.25e-19 83 38 2 123 3 folA Dihydrofolate reductase Mycobacterium leprae (strain TN)
O81395 2.19e-19 87 32 5 181 2 DRTS Bifunctional dihydrofolate reductase-thymidylate synthase Zea mays
P00382 2.74e-19 82 32 4 162 1 dhfrI Dihydrofolate reductase type 1 Escherichia coli
P00380 4.58e-19 82 33 5 163 1 folA Dihydrofolate reductase Enterococcus faecium
Q05762 1.03e-17 82 34 8 184 1 THY-1 Bifunctional dihydrofolate reductase-thymidylate synthase 1 Arabidopsis thaliana
Q59397 1.04e-17 79 35 2 132 3 dhfrIX Dihydrofolate reductase type 9 Escherichia coli
P9WNX1 2.03e-17 77 38 2 118 1 folA Dihydrofolate reductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNX0 2.03e-17 77 38 2 118 3 folA Dihydrofolate reductase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A547 2.03e-17 77 38 2 118 3 folA Dihydrofolate reductase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q59487 2.81e-17 77 31 5 154 3 folA Dihydrofolate reductase Lactococcus lactis subsp. lactis (strain IL1403)
P0ABQ8 8.14e-17 76 35 5 154 3 dhfrVIII Dihydrofolate reductase type 8 Shigella sonnei
P0ABQ7 8.14e-17 76 35 5 154 3 dhfrVIII Dihydrofolate reductase type 8 Escherichia coli
P22906 1.27e-16 76 35 6 148 1 DFR1 Dihydrofolate reductase Candida albicans
Q05763 2.28e-16 78 34 7 161 2 THY-2 Bifunctional dihydrofolate reductase-thymidylate synthase 2 Arabidopsis thaliana
G4VJD6 4.88e-16 74 30 5 175 1 DHFR Dihydrofolate reductase Schistosoma mansoni
P17719 8.5e-16 73 33 5 145 1 Dhfr Dihydrofolate reductase Drosophila melanogaster
Q2QRX6 8.95e-16 76 36 5 135 3 Os12g0446900 Putative bifunctional dihydrofolate reductase-thymidylate synthase Oryza sativa subsp. japonica
P45350 1.29e-15 76 30 7 181 2 None Bifunctional dihydrofolate reductase-thymidylate synthase Daucus carota
Q27828 1.39e-15 76 35 3 125 3 GSPATT00019973001 Bifunctional dihydrofolate reductase-thymidylate synthase Paramecium tetraurelia
P07807 2.1e-14 70 33 5 136 1 DFR1 Dihydrofolate reductase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q5V3R2 2.82e-14 70 27 5 165 3 folA1 Dihydrofolate reductase 1 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P51820 5.47e-14 71 33 5 145 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Glycine max
P28019 1.15e-13 68 30 5 152 3 DHFR Dihydrofolate reductase Aedes albopictus
P00381 2.23e-13 67 28 4 163 1 folA Dihydrofolate reductase Lacticaseibacillus casei
Q9U8B8 2.83e-13 67 32 6 154 1 DHFR Dihydrofolate reductase Heliothis virescens
P16184 2.24e-12 65 28 6 171 1 None Dihydrofolate reductase Pneumocystis carinii
Q98Q32 2.81e-11 62 27 5 158 3 folA Dihydrofolate reductase Mycoplasmopsis pulmonis (strain UAB CTIP)
P09503 6.26e-11 61 29 8 182 3 DHFR Viral dihydrofolate reductase Saimiriine herpesvirus 2 (strain 11)
P47470 6.62e-11 60 30 4 130 3 folA Dihydrofolate reductase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q9PR30 8.24e-11 60 27 4 140 3 folA Dihydrofolate reductase Ureaplasma parvum serovar 3 (strain ATCC 700970)
O62583 1.02e-10 60 34 4 123 3 DHFR-1 Dihydrofolate reductase Encephalitozoon cuniculi (strain GB-M1)
Q920D2 1.48e-10 60 29 9 184 1 Dhfr Dihydrofolate reductase Rattus norvegicus
Q60034 2.19e-10 59 33 7 124 1 folA Dihydrofolate reductase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P04753 2.71e-10 59 28 9 184 2 DHFR Dihydrofolate reductase Mesocricetus auratus
Q07801 3.74e-10 59 32 4 122 1 DFR1 Dihydrofolate reductase Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
Q93341 4.48e-10 58 30 7 173 3 dhfr-1 Putative dihydrofolate reductase Caenorhabditis elegans
P00375 4.78e-10 58 28 9 184 1 Dhfr Dihydrofolate reductase Mus musculus
Q5UQG3 1.89e-09 58 33 7 138 3 MIMI_R497 Bifunctional dihydrofolate reductase-thymidylate synthase Acanthamoeba polyphaga mimivirus
P00377 6.18e-09 55 29 7 154 1 DHFR Dihydrofolate reductase Sus scrofa
P13922 6.42e-09 57 33 4 108 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium falciparum (isolate K1 / Thailand)
Q07422 7.41e-09 57 27 6 187 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Toxoplasma gondii
P20712 1.32e-08 56 32 4 114 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium chabaudi
P16126 1.64e-08 55 29 8 182 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Leishmania amazonensis
Q7NB76 2e-08 55 26 4 138 3 scpA Segregation and condensation protein A Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
P78028 2.5e-08 53 25 5 153 3 folA Dihydrofolate reductase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P00376 3.43e-08 53 27 9 183 1 DHFR Dihydrofolate reductase Bos taurus
P36591 8.56e-08 53 26 6 172 2 dfr1 Dihydrofolate reductase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P75478 8.92e-08 53 30 2 104 3 scpA Segregation and condensation protein A Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q2HRC6 9.61e-08 52 32 8 141 3 ORF2 Putative Dihydrofolate reductase Human herpesvirus 8 type P (isolate GK18)
O02604 1.9e-07 52 30 4 111 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium vivax
P07382 2e-07 52 28 9 202 1 LmjF06.0860 Bifunctional dihydrofolate reductase-thymidylate synthase Leishmania major
Q27793 2.94e-07 52 30 8 168 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Trypanosoma cruzi
Q27783 4.52e-07 51 29 7 154 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Trypanosoma brucei brucei
Q23695 9.47e-07 50 34 6 135 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Crithidia fasciculata
Q27713 1.15e-05 47 32 4 111 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium berghei (strain Anka)
Q04515 8.6e-05 44 32 6 126 3 dfrA10 Dihydrofolate reductase type A10 Escherichia coli

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS11560
Feature type CDS
Gene folA
Product type 3 dihydrofolate reductase
Location 2549655 - 2550140 (strand: -1)
Length 486 (nucleotides) / 161 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_258
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00186 Dihydrofolate reductase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0262 Coenzyme transport and metabolism (H) H Dihydrofolate reductase

Kegg Ortholog Annotation(s)

Protein Sequence

MNISLIAALAADRIIGMEKAMPWTLPGDLAWFKKNTLNKPVIMGRVTYESIGRPLPNRLNIVLSSQPGNDDNVVWVKSVEEALQAAENNDEIMVIGGGKVYEQFLPMANKLYLTHIDAEVIGDTTFPDYEPDEWDSTFMEYHEADENNSHNYCFEILKRRK

Flanking regions ( +/- flanking 50bp)

CTTTCCGTATAGTATAAATAGTTTTCCCATTTTTACCCGTAGGTATGTAAATGAATATTAGTTTAATCGCAGCATTAGCGGCGGATCGTATTATTGGTATGGAAAAGGCGATGCCTTGGACATTACCTGGTGATCTCGCATGGTTTAAAAAAAATACATTAAATAAACCCGTTATTATGGGCCGGGTGACTTATGAGTCTATCGGGCGTCCTTTACCTAATCGTCTCAATATTGTATTAAGCAGTCAGCCTGGAAATGATGACAATGTTGTTTGGGTGAAATCCGTTGAAGAAGCACTACAAGCTGCTGAAAATAATGATGAAATCATGGTGATTGGTGGCGGTAAGGTTTATGAGCAATTCCTACCAATGGCGAATAAATTATACCTTACTCATATTGATGCTGAAGTGATTGGTGATACAACTTTCCCCGATTATGAGCCTGATGAGTGGGATTCTACTTTTATGGAATACCATGAGGCAGATGAAAATAATTCGCATAACTACTGTTTTGAAATATTAAAAAGAAGAAAATAACAAAATTTAAATAAAAAAGGAGATTAAATATCTCCTTTTTATTTTTATTA