Homologs in group_258

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06280 FBDBKF_06280 100.0 Morganella morganii S1 folA type 3 dihydrofolate reductase
EHELCC_09325 EHELCC_09325 100.0 Morganella morganii S2 folA type 3 dihydrofolate reductase
NLDBIP_09705 NLDBIP_09705 100.0 Morganella morganii S4 folA type 3 dihydrofolate reductase
LHKJJB_08050 LHKJJB_08050 100.0 Morganella morganii S3 folA type 3 dihydrofolate reductase
F4V73_RS15640 F4V73_RS15640 98.2 Morganella psychrotolerans folA type 3 dihydrofolate reductase
F4V73_RS17885 F4V73_RS17885 36.6 Morganella psychrotolerans - dihydrofolate reductase
PMI_RS11560 PMI_RS11560 82.0 Proteus mirabilis HI4320 folA type 3 dihydrofolate reductase

Distribution of the homologs in the orthogroup group_258

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_258

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P31073 1.79e-85 250 73 1 160 3 folA Dihydrofolate reductase Citrobacter freundii
P0ABQ6 5.07e-85 249 73 1 160 3 folA Dihydrofolate reductase Shigella flexneri
P0ABQ4 5.07e-85 249 73 1 160 1 folA Dihydrofolate reductase Escherichia coli (strain K12)
P0ABQ5 5.07e-85 249 73 1 160 3 folA Dihydrofolate reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P31074 5.6e-85 249 73 1 160 3 folA Dihydrofolate reductase Klebsiella aerogenes
P43791 4.86e-54 171 51 2 162 3 folA Dihydrofolate reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K9Z8 8.07e-52 165 50 3 163 3 folA Dihydrofolate reductase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57243 3.13e-50 161 46 3 163 3 folA Dihydrofolate reductase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P12833 6.5e-47 153 50 3 165 1 dhfrIII Dihydrofolate reductase type 3 Salmonella typhimurium
Q89AV2 2.46e-43 144 42 3 164 3 folA Dihydrofolate reductase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P11045 7.16e-37 127 39 2 163 1 dfrA Dihydrofolate reductase Bacillus subtilis (strain 168)
Q5V600 8.91e-34 119 48 2 141 3 folA2 Dihydrofolate reductase 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q54277 2.71e-33 118 37 2 162 1 dfrD Dihydrofolate reductase Staphylococcus haemolyticus
P04174 2.72e-32 115 44 3 139 1 folA Dihydrofolate reductase Neisseria gonorrhoeae
Q9JSQ9 2.49e-30 110 41 4 157 3 folA Dihydrofolate reductase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9K168 5.93e-30 110 44 3 139 3 folA Dihydrofolate reductase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A017 1.04e-28 106 34 2 164 1 folA Dihydrofolate reductase Staphylococcus aureus
Q6GGY1 1.04e-28 106 34 2 164 3 folA Dihydrofolate reductase Staphylococcus aureus (strain MRSA252)
P99079 1.04e-28 106 34 2 164 1 folA Dihydrofolate reductase Staphylococcus aureus (strain N315)
P0A016 1.04e-28 106 34 2 164 3 folA Dihydrofolate reductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFZ7 1.04e-28 106 34 2 164 3 folA Dihydrofolate reductase Staphylococcus aureus (strain COL)
P0C0P1 1.42e-28 106 35 2 164 3 folA Dihydrofolate reductase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPB1 1.42e-28 106 35 2 164 3 folA Dihydrofolate reductase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0C0P0 1.42e-28 106 35 2 164 1 folA Dihydrofolate reductase Staphylococcus epidermidis
P13955 2.24e-28 105 35 2 164 1 dfrA Dihydrofolate reductase type 1 from Tn4003 Staphylococcus aureus
Q9UWQ4 4.4e-28 106 41 4 168 1 hdrB Dihydrofolate reductase HdrB Haloferax volcanii
Q8NWQ9 9.83e-28 104 34 2 164 3 folA Dihydrofolate reductase Staphylococcus aureus (strain MW2)
Q6G9D5 9.83e-28 104 34 2 164 3 folA Dihydrofolate reductase Staphylococcus aureus (strain MSSA476)
Q54801 1.5e-26 101 34 6 172 1 dhfR Dihydrofolate reductase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P15093 8.22e-25 96 37 2 140 1 hdrA Dihydrofolate reductase HdrA Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q59408 4.86e-24 95 36 0 137 3 dfrA13 Dihydrofolate reductase type A13 Escherichia coli
P11731 2.53e-23 92 34 6 163 1 dhfrV Dihydrofolate reductase type 5 Escherichia coli
Q59487 8.82e-21 86 32 4 156 3 folA Dihydrofolate reductase Lactococcus lactis subsp. lactis (strain IL1403)
P95524 9.12e-21 86 37 4 142 3 dhfrVI Dihydrofolate reductase type 6 Proteus mirabilis
Q59397 5.35e-20 84 37 2 132 3 dhfrIX Dihydrofolate reductase type 9 Escherichia coli
P78218 1.45e-19 83 31 4 163 3 dhfrXV Dihydrofolate reductase type 15 Escherichia coli
Q9CBW1 2.86e-19 82 43 3 123 3 folA Dihydrofolate reductase Mycobacterium leprae (strain TN)
P00382 3.13e-19 82 31 4 163 1 dhfrI Dihydrofolate reductase type 1 Escherichia coli
P17719 7.73e-18 79 32 8 183 1 Dhfr Dihydrofolate reductase Drosophila melanogaster
P0ABQ8 9.01e-18 79 35 5 154 3 dhfrVIII Dihydrofolate reductase type 8 Shigella sonnei
P0ABQ7 9.01e-18 79 35 5 154 3 dhfrVIII Dihydrofolate reductase type 8 Escherichia coli
P9WNX1 1.4e-17 78 41 5 136 1 folA Dihydrofolate reductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNX0 1.4e-17 78 41 5 136 3 folA Dihydrofolate reductase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A547 1.4e-17 78 41 5 136 3 folA Dihydrofolate reductase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q05762 1.48e-17 82 33 8 184 1 THY-1 Bifunctional dihydrofolate reductase-thymidylate synthase 1 Arabidopsis thaliana
G4VJD6 2.01e-17 78 31 5 174 1 DHFR Dihydrofolate reductase Schistosoma mansoni
Q5V3R2 3e-17 77 30 4 165 3 folA1 Dihydrofolate reductase 1 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
O81395 3.21e-17 81 33 7 164 2 DRTS Bifunctional dihydrofolate reductase-thymidylate synthase Zea mays
P27422 3.29e-17 77 35 4 145 3 dhfrVII Dihydrofolate reductase type 7 Escherichia coli
P16184 7.67e-17 77 30 6 171 1 None Dihydrofolate reductase Pneumocystis carinii
Q27828 3.86e-16 77 29 5 164 3 GSPATT00019973001 Bifunctional dihydrofolate reductase-thymidylate synthase Paramecium tetraurelia
Q05763 4.59e-16 77 32 7 161 2 THY-2 Bifunctional dihydrofolate reductase-thymidylate synthase 2 Arabidopsis thaliana
P00380 7.96e-16 73 36 5 130 1 folA Dihydrofolate reductase Enterococcus faecium
P22906 1.43e-15 73 38 7 131 1 DFR1 Dihydrofolate reductase Candida albicans
P00381 2.75e-15 72 34 2 125 1 folA Dihydrofolate reductase Lacticaseibacillus casei
P45350 7.82e-15 74 32 7 161 2 None Bifunctional dihydrofolate reductase-thymidylate synthase Daucus carota
Q2QRX6 8.34e-15 73 30 5 160 3 Os12g0446900 Putative bifunctional dihydrofolate reductase-thymidylate synthase Oryza sativa subsp. japonica
P28019 1.09e-14 71 32 6 151 3 DHFR Dihydrofolate reductase Aedes albopictus
P07807 4.09e-14 70 28 9 197 1 DFR1 Dihydrofolate reductase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P51820 9.12e-14 71 31 5 145 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Glycine max
Q9U8B8 9.84e-13 65 31 6 154 1 DHFR Dihydrofolate reductase Heliothis virescens
Q60034 1.14e-12 65 32 8 161 1 folA Dihydrofolate reductase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q920D2 1.28e-12 65 31 10 184 1 Dhfr Dihydrofolate reductase Rattus norvegicus
Q9PR30 1.63e-12 64 28 6 153 3 folA Dihydrofolate reductase Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q98Q32 1.71e-12 65 29 5 160 3 folA Dihydrofolate reductase Mycoplasmopsis pulmonis (strain UAB CTIP)
P00375 1.88e-12 65 31 9 183 1 Dhfr Dihydrofolate reductase Mus musculus
P04753 3.01e-12 64 29 9 184 2 DHFR Dihydrofolate reductase Mesocricetus auratus
P47470 3.18e-12 63 30 6 139 3 folA Dihydrofolate reductase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P78028 3.5e-12 63 27 3 139 3 folA Dihydrofolate reductase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P36591 3.55e-12 66 28 9 172 2 dfr1 Dihydrofolate reductase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P00377 5.87e-12 63 29 8 182 1 DHFR Dihydrofolate reductase Sus scrofa
P09503 9.23e-12 63 27 8 182 3 DHFR Viral dihydrofolate reductase Saimiriine herpesvirus 2 (strain 11)
O62583 1.54e-11 63 32 4 150 3 DHFR-1 Dihydrofolate reductase Encephalitozoon cuniculi (strain GB-M1)
P00378 3.27e-11 62 28 8 183 1 DHFR Dihydrofolate reductase Gallus gallus
Q07422 8.06e-11 62 29 6 187 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Toxoplasma gondii
P00376 9.09e-11 60 29 9 185 1 DHFR Dihydrofolate reductase Bos taurus
Q7NB76 2.43e-09 58 26 3 152 3 scpA Segregation and condensation protein A Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
P13922 2.71e-09 58 31 3 104 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium falciparum (isolate K1 / Thailand)
P75478 3.1e-09 58 32 2 106 3 scpA Segregation and condensation protein A Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q93341 3.58e-09 56 31 6 145 3 dhfr-1 Putative dihydrofolate reductase Caenorhabditis elegans
O02604 3.96e-09 57 30 3 107 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium vivax
P00374 5.58e-09 55 26 9 184 1 DHFR Dihydrofolate reductase Homo sapiens
P20712 6.75e-09 57 29 4 134 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium chabaudi
P22573 7.31e-09 55 28 10 181 3 DHFR Viral dihydrofolate reductase Saimiriine herpesvirus 2 (strain 488)
P27421 1.03e-08 55 28 10 181 3 DHFR Viral dihydrofolate reductase Saimiriine herpesvirus 2 (strain 484-77)
P07382 2.28e-08 55 30 9 202 1 LmjF06.0860 Bifunctional dihydrofolate reductase-thymidylate synthase Leishmania major
Q27783 4.55e-08 54 32 7 142 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Trypanosoma brucei brucei
P16126 4.95e-08 54 28 9 202 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Leishmania amazonensis
Q07801 7.87e-08 53 26 5 171 1 DFR1 Dihydrofolate reductase Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
Q27793 1.2e-07 53 30 7 168 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Trypanosoma cruzi
Q27713 4.39e-07 52 30 3 111 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium berghei (strain Anka)
Q23695 2.28e-06 49 28 6 164 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Crithidia fasciculata
Q04515 2.52e-06 48 31 7 140 3 dfrA10 Dihydrofolate reductase type A10 Escherichia coli

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_07600
Feature type CDS
Gene folA
Product type 3 dihydrofolate reductase
Location 127533 - 128027 (strand: 1)
Length 495 (nucleotides) / 164 (amino acids)
In genomic island -

Contig

Accession ZDB_684
Length 217237 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_258
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00186 Dihydrofolate reductase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0262 Coenzyme transport and metabolism (H) H Dihydrofolate reductase

Kegg Ortholog Annotation(s)

Protein Sequence

MNISLIAALAMDRVIGMENAMPWTLPEDLAWFKRNTVNKPVIMGRVTYESIGRPLPDRLNIVLSRTPGNDDRVVWAKSVEEALAIAQKETDGEIMVMGGGKVYGQFLPLADRLYLTHVDAEVSGDTYFPDYEPDEWDSTFMEYHDADEANSHGFCFEILERRKS

Flanking regions ( +/- flanking 50bp)

AGTTTACGTATAGTGACGGCAAAATTTCTCTCAGCCCTAAGGTGAAATGAATGAACATTAGCTTGATCGCTGCTTTAGCTATGGATCGGGTTATTGGCATGGAAAATGCGATGCCATGGACACTGCCGGAAGACCTGGCATGGTTTAAACGTAATACGGTGAATAAACCGGTGATCATGGGTCGTGTGACTTATGAATCTATCGGCCGTCCTCTGCCGGATCGCCTCAATATCGTGCTCAGCCGTACGCCGGGCAACGATGATCGCGTGGTCTGGGCGAAGTCTGTGGAAGAAGCACTGGCGATTGCACAGAAAGAAACAGACGGTGAGATCATGGTAATGGGCGGCGGTAAAGTCTACGGACAATTCCTGCCGCTGGCGGATCGTTTATATCTGACACACGTTGATGCGGAAGTCAGCGGGGATACTTACTTCCCTGACTATGAGCCGGATGAGTGGGACTCCACTTTTATGGAATATCATGACGCGGATGAAGCAAACTCTCACGGTTTCTGCTTTGAAATCTTAGAGCGCCGTAAGAGCTGATTAATCAGTTGATTCGTATTATTTCATAAATAATGCTGATATAAAAAAAG