Homologs in group_51

Help

13 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09045 FBDBKF_09045 34.7 Morganella morganii S1 - Fimbria A protein
EHELCC_10365 EHELCC_10365 34.7 Morganella morganii S2 - Fimbria A protein
NLDBIP_10710 NLDBIP_10710 34.7 Morganella morganii S4 - Fimbria A protein
LHKJJB_10645 LHKJJB_10645 34.7 Morganella morganii S3 - Fimbria A protein
HKOGLL_13705 HKOGLL_13705 34.7 Morganella morganii S5 - Fimbria A protein
F4V73_RS10925 F4V73_RS10925 34.7 Morganella psychrotolerans - fimbrial protein
PMI_RS01230 PMI_RS01230 35.3 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS01275 PMI_RS01275 34.7 Proteus mirabilis HI4320 mrpA MR/P fimbria major subunit MrpA
PMI_RS01430 PMI_RS01430 32.8 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS01435 PMI_RS01435 19.0 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS01455 PMI_RS01455 21.5 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS09265 PMI_RS09265 26.6 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS10950 PMI_RS10950 23.7 Proteus mirabilis HI4320 - fimbrial protein

Distribution of the homologs in the orthogroup group_51

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_51

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P04740 1.2e-39 136 46 4 178 3 KS71A KS71A fimbrillin Escherichia coli
P04127 1.74e-36 128 42 5 179 1 papA Pap fimbrial major pilin protein Escherichia coli
P62607 2.04e-32 117 41 5 179 3 F7-2 F7-2 fimbrial protein Escherichia coli
P62608 2.04e-32 117 41 5 179 3 F7-2 F7-2 fimbrial protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P42184 5.78e-32 115 44 6 164 1 prsA PRS fimbrial major pilin protein (Fragment) Escherichia coli
P13421 5.2e-23 93 33 4 185 1 smfA Fimbria A protein Serratia marcescens
P43660 6.66e-20 85 37 6 183 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q03011 6.85e-20 85 32 3 185 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P37909 3.07e-19 83 32 6 184 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
Q8X5K5 6.95e-15 72 33 6 181 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P39834 1.29e-09 58 28 7 175 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
P37921 2.2e-09 57 32 8 190 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37920 2.21e-08 54 33 9 191 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
Q04681 1.3e-07 52 27 10 203 1 pmfA Major fimbrial subunit Proteus mirabilis (strain HI4320)
P55223 4.52e-07 51 31 7 160 3 None Fimbrial subunit type 1 Salmonella typhimurium
P12903 7.63e-07 50 27 4 152 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P21413 9.26e-07 50 31 3 115 3 fasA Fimbrial protein 987P Escherichia coli
Q03846 1.23e-06 50 33 2 93 3 hifA Major fimbrial subunit Haemophilus influenzae
P62605 9.98e-06 47 31 5 119 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 9.98e-06 47 31 5 119 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P42185 1.58e-05 47 26 5 159 3 prsH PRS fimbrial minor pilin protein Escherichia coli
Q47223 1.84e-05 46 30 3 106 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P12730 4.6e-05 45 35 3 90 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P07111 6.4e-05 45 25 5 159 1 papH PAP fimbrial minor pilin protein Escherichia coli
P11312 7.58e-05 44 27 5 164 3 F17a-A F17 fimbrial protein Escherichia coli
P53521 8.44e-05 44 27 6 168 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)
P75855 0.000142 43 27 9 193 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
Q8X582 0.00027 43 27 8 191 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
P42913 0.000283 43 24 6 203 2 yraH Uncharacterized fimbrial-like protein YraH Escherichia coli (strain K12)
P77288 0.000544 42 32 1 80 2 yfcV Uncharacterized fimbrial-like protein YfcV Escherichia coli (strain K12)
P22595 0.000687 42 27 8 183 3 fimA Type-1 fimbrial protein subunit Serratia marcescens

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10955
Feature type CDS
Gene -
Product fimbrial protein
Location 2411989 - 2412540 (strand: -1)
Length 552 (nucleotides) / 183 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_51
Orthogroup size 14
N. genomes 7

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12517 major pilin subunit PapA - -

Protein Sequence

MKLNKLAMFAIASMAFSATVAQAASGDGTITFTGKVIDAPCGIATESANQAIDFGQISKSLLEKDGISQVKQIPIKLVNCDLTKAGSDTGAAGSYKGVKVTFNGNTITGATEELATTGNTGTAIVISGTTTGSMVKFNEAGELQALGNNDNTLMYTAWAKKATNGTIAEGEFNATTNFTLAYE

Flanking regions ( +/- flanking 50bp)

AGTTAATTTTTTAACGCTTTAATTCCTACGTTAAATATAAAGGTAAAAATATGAAATTGAATAAATTAGCGATGTTCGCTATTGCATCAATGGCTTTTTCTGCGACTGTTGCTCAAGCGGCTTCAGGTGATGGTACTATTACTTTCACTGGTAAAGTTATTGATGCACCTTGTGGTATTGCTACCGAAAGTGCTAACCAAGCTATCGATTTTGGTCAAATCAGCAAAAGCCTATTAGAGAAAGATGGTATTTCTCAAGTTAAACAAATCCCAATTAAATTGGTTAATTGTGATTTAACTAAAGCCGGTTCTGATACTGGTGCTGCAGGTTCTTATAAAGGCGTAAAAGTAACCTTTAATGGAAATACTATTACTGGTGCAACAGAAGAGTTAGCAACAACTGGTAATACAGGGACTGCTATTGTTATTTCAGGAACAACAACTGGTTCAATGGTTAAATTCAATGAAGCAGGTGAATTACAAGCACTGGGTAATAATGATAATACGCTGATGTATACAGCTTGGGCTAAGAAAGCAACAAACGGAACAATTGCTGAAGGTGAGTTTAACGCTACAACAAACTTCACATTAGCCTATGAATAAAAAATATTAAATTTAACGAGAGCAGTTAATCTGCTCTCGATTATTTAAGG