Homologs in group_34

Help

14 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13325 FBDBKF_13325 85.2 Morganella morganii S1 araC AraC-type DNA-binding domain and AraC-containing proteins
EHELCC_08770 EHELCC_08770 85.2 Morganella morganii S2 araC AraC-type DNA-binding domain and AraC-containing proteins
NLDBIP_09095 NLDBIP_09095 85.2 Morganella morganii S4 araC AraC-type DNA-binding domain and AraC-containing proteins
LHKJJB_05170 LHKJJB_05170 85.2 Morganella morganii S3 araC AraC-type DNA-binding domain and AraC-containing proteins
HKOGLL_05745 HKOGLL_05745 85.2 Morganella morganii S5 araC AraC-type DNA-binding domain and AraC-containing proteins
F4V73_RS01705 F4V73_RS01705 33.6 Morganella psychrotolerans - AraC family transcriptional regulator
F4V73_RS03430 F4V73_RS03430 84.4 Morganella psychrotolerans - helix-turn-helix domain-containing protein
F4V73_RS04165 F4V73_RS04165 27.2 Morganella psychrotolerans - AraC family transcriptional regulator
F4V73_RS04870 F4V73_RS04870 26.0 Morganella psychrotolerans - AraC family transcriptional regulator
F4V73_RS12525 F4V73_RS12525 29.4 Morganella psychrotolerans - AraC family transcriptional regulator
F4V73_RS17025 F4V73_RS17025 47.3 Morganella psychrotolerans - helix-turn-helix domain-containing protein
PMI_RS04495 PMI_RS04495 29.2 Proteus mirabilis HI4320 - helix-turn-helix domain-containing protein
PMI_RS14600 PMI_RS14600 30.7 Proteus mirabilis HI4320 chbR transcriptional regulator ChbR
PMI_RS18315 PMI_RS18315 27.5 Proteus mirabilis HI4320 - AraC family transcriptional regulator

Distribution of the homologs in the orthogroup group_34

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_34

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q52620 3e-83 241 95 0 120 4 pqrA Probable transcription factor PqrA Proteus vulgaris
Q48413 1.13e-31 111 45 1 106 1 ramA Transcriptional activator RamA Klebsiella pneumoniae
A0A0H3GPK2 1.13e-31 111 45 1 106 1 ramA Transcriptional regulator RamA Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
H9L484 1.52e-31 110 47 2 110 1 ramA Transcriptional regulator RamA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P55922 4.74e-30 107 44 1 106 4 ramA Transcriptional activator RamA Enterobacter cloacae
Q8ZJU7 6.23e-30 111 50 1 106 2 rob Transcriptional regulator Rob Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0ACI2 1.73e-29 110 50 1 106 3 rob Right origin-binding protein Shigella flexneri
P0ACI0 1.73e-29 110 50 1 106 1 rob Right origin-binding protein Escherichia coli (strain K12)
P0ACI1 1.73e-29 110 50 1 106 3 rob Right origin-binding protein Escherichia coli O157:H7
P0A9E2 1.3e-28 103 41 1 104 1 soxS Regulatory protein SoxS Escherichia coli (strain K12)
P0A9E3 1.3e-28 103 41 1 104 3 soxS Regulatory protein SoxS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9E4 1.3e-28 103 41 1 104 3 soxS Regulatory protein SoxS Escherichia coli O157:H7
P43463 2.28e-28 103 44 1 102 4 aarP HTH-type transcriptional activator AarP Providencia stuartii
Q56143 3.5e-28 102 41 1 103 3 soxS Regulatory protein SoxS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2S4 4.84e-27 99 43 2 108 2 marA Multiple antibiotic resistance protein MarA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2S5 4.84e-27 99 43 2 108 3 marA Multiple antibiotic resistance protein MarA Salmonella typhi
P0A2S6 4.84e-27 99 43 2 108 3 marA Multiple antibiotic resistance protein MarA Salmonella enteritidis
P28816 9.6e-27 99 46 1 101 1 tetD Transposon Tn10 TetD protein Escherichia coli
P0ACH7 1.01e-26 99 43 1 101 3 marA Multiple antibiotic resistance protein MarA Shigella flexneri
P0ACH5 1.01e-26 99 43 1 101 1 marA Multiple antibiotic resistance protein MarA Escherichia coli (strain K12)
P0ACH6 1.01e-26 99 43 1 101 3 marA Multiple antibiotic resistance protein MarA Escherichia coli O157:H7
P77601 1.21e-20 86 42 1 103 5 ykgA Putative HTH-type transcriptional regulator YkgA Escherichia coli (strain K12)
O31456 4.62e-14 69 41 1 103 3 ybfP Uncharacterized HTH-type transcriptional regulator YbfP Bacillus subtilis (strain 168)
P96662 3.02e-13 67 33 1 103 4 ydeE Uncharacterized HTH-type transcriptional regulator YdeE Bacillus subtilis (strain 168)
P19219 8.53e-13 65 34 0 93 1 adaA Bifunctional transcriptional activator/DNA repair enzyme AdaA Bacillus subtilis (strain 168)
P26950 1.5e-11 62 37 1 105 4 caf1R F1 operon positive regulatory protein Yersinia pestis
O87389 2.54e-11 62 35 1 97 4 glxA HTH-type transcriptional regulator GlxA Rhizobium meliloti (strain 1021)
Q47129 8.16e-10 58 34 2 89 1 feaR Transcriptional activator FeaR Escherichia coli (strain K12)
Q9HTI4 1.46e-09 57 28 1 101 1 gbdR HTH-type transcriptional regulator GbdR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0A0H2ZIC3 1.46e-09 57 28 1 101 1 gbdR HTH-type transcriptional regulator GbdR Pseudomonas aeruginosa (strain UCBPP-PA14)
Q6GKK1 2.01e-09 57 30 2 111 4 SAR0107 Uncharacterized HTH-type transcriptional regulator SAR0107 Staphylococcus aureus (strain MRSA252)
Q5HJR8 2.01e-09 57 30 2 111 4 SACOL0084 Uncharacterized HTH-type transcriptional regulator SACOL0084 Staphylococcus aureus (strain COL)
Q99XB1 2.34e-09 57 30 2 111 4 SAV0101 Uncharacterized HTH-type transcriptional regulator SAV0101 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A882 2.34e-09 57 30 2 111 4 SA0097 Uncharacterized HTH-type transcriptional regulator SA0097 Staphylococcus aureus (strain N315)
Q6GD21 2.41e-09 57 30 2 111 4 SAS0078 Uncharacterized HTH-type transcriptional regulator SAS0078 Staphylococcus aureus (strain MSSA476)
Q8NYT6 2.41e-09 57 30 2 111 4 MW0077 Uncharacterized HTH-type transcriptional regulator MW0077 Staphylococcus aureus (strain MW2)
P45008 2.75e-09 56 32 0 82 4 HI_1052 Uncharacterized HTH-type transcriptional regulator HI_1052 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q05587 3.91e-09 56 24 1 97 1 pocR Regulatory protein PocR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P26993 6.73e-09 55 32 0 83 1 exsA HTH-type transcriptional regulator ExsA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q00753 8.97e-09 55 28 1 101 4 msmR Msm operon regulatory protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q936F1 9.1e-09 55 30 2 111 4 None Uncharacterized HTH-type transcriptional regulator Staphylococcus aureus
B5YZ43 9.34e-09 55 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X897 9.34e-09 55 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O157:H7
Q83PE0 1.03e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Shigella flexneri
Q0SZ95 1.03e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Shigella flexneri serotype 5b (strain 8401)
Q0TAF8 1.07e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UNM6 1.07e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1LMU6 1.09e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain SMS-3-5 / SECEC)
Q32A70 1.12e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Shigella dysenteriae serotype 1 (strain Sd197)
Q31U84 1.12e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Shigella boydii serotype 4 (strain Sb227)
P09377 1.12e-08 54 30 1 101 1 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12)
B1IVH3 1.12e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A709 1.12e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O9:H4 (strain HS)
B1XB72 1.12e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12 / DH10B)
C5A073 1.12e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6V7 1.12e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O8 (strain IAI1)
B7L9G1 1.12e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain 55989 / EAEC)
Q3YV71 1.14e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Shigella sonnei (strain Ss046)
Q8CXW5 1.15e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7N2P7 1.16e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O81 (strain ED1a)
Q1R414 1.23e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain UTI89 / UPEC)
B7NFK3 1.23e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A1AI82 1.23e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O1:K1 / APEC
B7NUA1 1.23e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MI37 1.23e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O45:K1 (strain S88 / ExPEC)
P0ACI3 1.57e-08 54 32 0 85 1 xylR Xylose operon regulatory protein Escherichia coli (strain K12)
P0ACI4 1.57e-08 54 32 0 85 3 xylR Xylose operon regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACI5 1.57e-08 54 32 0 85 3 xylR Xylose operon regulatory protein Escherichia coli O157:H7
A7ZUB7 1.69e-08 54 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O139:H28 (strain E24377A / ETEC)
P0C2V5 1.71e-08 54 32 0 85 2 virF Virulence regulon transcriptional activator VirF Yersinia enterocolitica
A8AL27 1.73e-08 54 31 1 101 3 rhaS HTH-type transcriptional activator RhaS Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P28808 1.89e-08 53 32 0 85 4 lcrF Thermoregulatory protein LcrF Yersinia pestis
B6I4P8 2.17e-08 53 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain SE11)
B2TVP7 2.3e-08 53 30 1 101 3 rhaS HTH-type transcriptional activator RhaS Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
O31449 2.41e-08 53 33 1 84 4 ybfI Uncharacterized HTH-type transcriptional regulator YbfI Bacillus subtilis (strain 168)
A4WG91 2.44e-08 53 29 1 101 3 rhaS HTH-type transcriptional activator RhaS Enterobacter sp. (strain 638)
A1JU91 2.81e-08 53 32 0 85 3 virF Virulence regulon transcriptional activator VirF Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8ZM00 9.99e-08 52 32 2 91 1 STM3175 Probable HTH-type transcriptional regulator STM3175 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5FPP5 1.19e-07 51 28 1 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella dublin (strain CT_02021853)
Q9WW32 1.24e-07 52 30 0 84 1 mtrA HTH-type transcriptional regulator MtrA Neisseria gonorrhoeae
B4TBY3 1.28e-07 51 28 1 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella heidelberg (strain SL476)
Q8FQS2 1.3e-07 52 34 1 85 3 ripA HTH-type transcriptional regulator RipA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P0A2S9 1.3e-07 51 28 1 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2T0 1.3e-07 51 28 1 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella typhi
B4TPQ9 1.3e-07 51 28 1 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella schwarzengrund (strain CVM19633)
C0Q3L4 1.3e-07 51 28 1 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi C (strain RKS4594)
A9MZC8 1.3e-07 51 28 1 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SZZ3 1.3e-07 51 28 1 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella newport (strain SL254)
B5RFC3 1.3e-07 51 28 1 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QWY4 1.3e-07 51 28 1 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella enteritidis PT4 (strain P125109)
A9MI64 1.3e-07 51 28 1 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F0M9 1.3e-07 51 28 1 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella agona (strain SL483)
B5BJG8 1.33e-07 51 28 1 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi A (strain AKU_12601)
Q5PKG2 1.33e-07 51 28 1 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57HG8 1.4e-07 51 28 1 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella choleraesuis (strain SC-B67)
A9QYR8 2.18e-07 51 29 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis bv. Antiqua (strain Angola)
O32071 2.21e-07 51 31 1 106 4 ytdP Uncharacterized HTH-type transcriptional regulator YtdP Bacillus subtilis (strain 168)
B1JNC5 2.34e-07 50 29 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TRS8 2.34e-07 50 29 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis (strain Pestoides F)
B2K1W5 2.34e-07 50 29 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FN80 2.34e-07 50 29 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q66FF2 2.41e-07 50 29 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype I (strain IP32953)
O33813 2.82e-07 50 26 1 98 4 lacR Lactose operon transcription activator Staphylococcus xylosus
Q65Q30 3.5e-07 50 35 0 67 3 rhaR HTH-type transcriptional activator RhaR Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B5XZ49 4.2e-07 50 29 1 101 3 rhaS HTH-type transcriptional activator RhaS Klebsiella pneumoniae (strain 342)
A6TGA9 6.99e-07 49 29 1 101 3 rhaS HTH-type transcriptional activator RhaS Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q1CEB5 1.26e-06 48 28 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZJ00 1.26e-06 48 28 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis
Q1C0W1 1.26e-06 48 28 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis bv. Antiqua (strain Antiqua)
P77379 1.35e-06 48 26 0 82 1 rclR RCS-specific HTH-type transcriptional activator RclR Escherichia coli (strain K12)
P54722 2.27e-06 48 31 1 86 4 yfiF Uncharacterized HTH-type transcriptional regulator YfiF Bacillus subtilis (strain 168)
P17410 4.01e-06 47 26 1 109 1 chbR HTH-type transcriptional regulator ChbR Escherichia coli (strain K12)
G3XCU2 5.25e-06 47 33 0 81 4 argR HTH-type transcriptional regulator ArgR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P95283 6.15e-06 47 29 0 82 2 Rv1931c HTH-type transcriptional regulator Rv1931c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P45043 1.02e-05 46 30 0 83 3 xylR Xylose operon regulatory protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P07642 1.07e-05 46 27 0 83 3 araC Arabinose operon regulatory protein Dickeya chrysanthemi
Q8NRR3 1.35e-05 46 33 1 81 2 ripA HTH-type transcriptional regulator RipA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P0ACH8 1.53e-05 45 27 0 87 1 melR Melibiose operon regulatory protein Escherichia coli (strain K12)
P0ACH9 1.53e-05 45 27 0 87 3 melR Melibiose operon regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P35319 1.84e-05 45 26 1 111 4 None Putative AraC-like transcription regulator Streptomyces lividans
Q65Q31 2.16e-05 45 28 1 97 3 rhaS HTH-type transcriptional activator RhaS Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P43461 2.47e-05 44 33 1 83 4 None Uncharacterized HTH-type transcriptional regulator in cgkA 5'region (Fragment) Pseudoalteromonas carrageenovora
B4TPR0 3.33e-05 45 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella schwarzengrund (strain CVM19633)
A6TGB0 4e-05 44 26 0 82 3 rhaR HTH-type transcriptional activator RhaR Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
C6DJR5 4.38e-05 44 26 0 83 3 rhaR HTH-type transcriptional activator RhaR Pectobacterium carotovorum subsp. carotovorum (strain PC1)
P77396 4.47e-05 44 29 0 79 4 ypdC Uncharacterized HTH-type transcriptional regulator YpdC Escherichia coli (strain K12)
B1Q2A8 5.08e-05 44 28 2 89 1 nphR Transcriptional activator NphR Rhodococcus sp.
T2KMF4 6.15e-05 44 29 0 86 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
P40408 6.56e-05 44 25 0 82 1 btr HTH-type transcriptional activator Btr Bacillus subtilis (strain 168)
Q6DA21 7.84e-05 43 25 0 83 3 rhaR HTH-type transcriptional activator RhaR Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B5FPP6 0.000156 43 23 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella dublin (strain CT_02021853)
P40865 0.000157 43 25 0 81 3 rhaR HTH-type transcriptional activator RhaR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BJG9 0.000157 43 25 0 81 3 rhaR HTH-type transcriptional activator RhaR Salmonella paratyphi A (strain AKU_12601)
A9MZC9 0.000157 43 25 0 81 3 rhaR HTH-type transcriptional activator RhaR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKG1 0.000157 43 25 0 81 3 rhaR HTH-type transcriptional activator RhaR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SZZ4 0.000157 43 25 0 81 3 rhaR HTH-type transcriptional activator RhaR Salmonella newport (strain SL254)
B5QWY5 0.000157 43 25 0 81 3 rhaR HTH-type transcriptional activator RhaR Salmonella enteritidis PT4 (strain P125109)
B5F0N0 0.000157 43 25 0 81 3 rhaR HTH-type transcriptional activator RhaR Salmonella agona (strain SL483)
A9MI63 0.00017 42 25 0 81 3 rhaR HTH-type transcriptional activator RhaR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q32A71 0.000182 42 23 1 105 3 rhaR HTH-type transcriptional activator RhaR Shigella dysenteriae serotype 1 (strain Sd197)
Q8X7B3 0.000187 42 23 1 105 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O157:H7
P09378 0.000195 42 23 1 105 1 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain K12)
A8A710 0.000195 42 23 1 105 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O9:H4 (strain HS)
C5A074 0.000195 42 23 1 105 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain K12 / MC4100 / BW2952)
Q1R413 0.000198 42 23 1 105 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain UTI89 / UPEC)
A1AI83 0.000198 42 23 1 105 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O1:K1 / APEC
Q31U83 0.000202 42 23 1 105 3 rhaR HTH-type transcriptional activator RhaR Shigella boydii serotype 4 (strain Sb227)
Q8FBD7 0.000202 42 23 1 105 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAF7 0.000202 42 23 1 105 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZUB8 0.000202 42 23 1 105 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83PD9 0.000214 42 23 1 105 3 rhaR HTH-type transcriptional activator RhaR Shigella flexneri
Q0SZ96 0.000214 42 23 1 105 3 rhaR HTH-type transcriptional activator RhaR Shigella flexneri serotype 5b (strain 8401)
Q57HG7 0.000238 42 24 0 81 3 rhaR HTH-type transcriptional activator RhaR Salmonella choleraesuis (strain SC-B67)
Q8Z2V5 0.000245 42 24 0 81 3 rhaR HTH-type transcriptional activator RhaR Salmonella typhi
B4TBY4 0.000245 42 24 0 81 3 rhaR HTH-type transcriptional activator RhaR Salmonella heidelberg (strain SL476)
Q6NI56 0.000276 42 28 2 103 3 ripA HTH-type transcriptional regulator RipA Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
O31249 0.000297 42 25 0 82 4 alkR HTH-type transcriptional regulator AlkR Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
O31517 0.000298 42 34 2 70 3 yesN Uncharacterized transcriptional regulatory protein YesN Bacillus subtilis (strain 168)
P43464 0.000317 42 38 0 55 4 aggR Transcriptional activator AggR Escherichia coli
P11765 0.000347 42 25 1 103 3 araC Arabinose operon regulatory protein Citrobacter freundii
A4WG90 0.000379 42 23 0 86 3 rhaR HTH-type transcriptional activator RhaR Enterobacter sp. (strain 638)
Q9HTH5 0.00057 41 26 0 78 1 cdhR HTH-type transcriptional regulator CdhR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B1JNC4 0.000586 41 26 1 99 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
P16114 0.000669 41 29 3 124 1 rns Regulatory protein Rns Escherichia coli
Q66FF1 0.000671 41 26 1 99 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FN79 0.000671 41 26 1 99 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TRS7 0.000684 41 26 1 99 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis (strain Pestoides F)
Q1CEB6 0.000684 41 26 1 99 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYR6 0.000684 41 26 1 99 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIZ9 0.000684 41 26 1 99 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis
B2K1W6 0.000684 41 26 1 99 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0W2 0.000684 41 26 1 99 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Antiqua)
O31522 0.000832 41 28 1 84 2 yesS HTH-type transcriptional regulator YesS Bacillus subtilis (strain 168)
P43459 0.001 40 32 1 58 4 perA Transcriptional activator PerA Escherichia coli O127:H6 (strain E2348/69 / EPEC)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05115
Feature type CDS
Gene -
Product helix-turn-helix domain-containing protein
Location 1116915 - 1117283 (strand: -1)
Length 369 (nucleotides) / 122 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_34
Orthogroup size 15
N. genomes 7

Actions

Genomic region

Domains

PF12833 Helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2207 Transcription (K) K AraC-type DNA-binding domain and AraC-containing proteins

Protein Sequence

MAENVVNDILKWLETQLQRNEGIKIDTIANKSGYSKWHLQRIFKDFKGCTLGEYVRKRRLLEAAKSLQEKDMSILDIALMYGFSSQATFTRIFKKHFNTTPAKFREHGELPDTRRFMSCENS

Flanking regions ( +/- flanking 50bp)

CTATTCTATTTAATTGGGCACTATGTCCCCACCTATTGTGGGAGGTTTTTATGGCTGAAAATGTCGTTAATGATATTCTGAAATGGTTAGAAACTCAGTTACAACGTAATGAGGGTATAAAGATTGATACGATTGCAAATAAAAGTGGCTACTCCAAGTGGCATTTGCAACGTATTTTTAAAGATTTTAAAGGTTGCACATTAGGCGAATATGTACGTAAACGTCGCTTATTGGAAGCAGCAAAGTCTTTACAAGAAAAAGACATGTCCATTTTAGATATTGCTTTGATGTATGGCTTTAGTTCCCAAGCAACATTTACTCGTATCTTTAAAAAACACTTCAACACTACACCAGCTAAATTTAGAGAACATGGTGAGTTACCAGATACACGTCGTTTTATGTCATGTGAAAATAGCTAATATAGCCAGAAGTATTGACTGACAAAACAAAGCGGGAAAACATCATGTTT