Homologs in group_34

Help

14 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_08770 EHELCC_08770 100.0 Morganella morganii S2 araC AraC-type DNA-binding domain and AraC-containing proteins
NLDBIP_09095 NLDBIP_09095 100.0 Morganella morganii S4 araC AraC-type DNA-binding domain and AraC-containing proteins
LHKJJB_05170 LHKJJB_05170 100.0 Morganella morganii S3 araC AraC-type DNA-binding domain and AraC-containing proteins
HKOGLL_05745 HKOGLL_05745 100.0 Morganella morganii S5 araC AraC-type DNA-binding domain and AraC-containing proteins
F4V73_RS01705 F4V73_RS01705 36.1 Morganella psychrotolerans - AraC family transcriptional regulator
F4V73_RS03430 F4V73_RS03430 92.6 Morganella psychrotolerans - helix-turn-helix domain-containing protein
F4V73_RS04165 F4V73_RS04165 26.2 Morganella psychrotolerans - AraC family transcriptional regulator
F4V73_RS04870 F4V73_RS04870 27.1 Morganella psychrotolerans - AraC family transcriptional regulator
F4V73_RS12525 F4V73_RS12525 31.2 Morganella psychrotolerans - AraC family transcriptional regulator
F4V73_RS17025 F4V73_RS17025 44.6 Morganella psychrotolerans - helix-turn-helix domain-containing protein
PMI_RS04495 PMI_RS04495 28.3 Proteus mirabilis HI4320 - helix-turn-helix domain-containing protein
PMI_RS05115 PMI_RS05115 85.2 Proteus mirabilis HI4320 - helix-turn-helix domain-containing protein
PMI_RS14600 PMI_RS14600 30.7 Proteus mirabilis HI4320 chbR transcriptional regulator ChbR
PMI_RS18315 PMI_RS18315 27.5 Proteus mirabilis HI4320 - AraC family transcriptional regulator

Distribution of the homologs in the orthogroup group_34

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_34

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q52620 2.92e-76 224 84 0 122 4 pqrA Probable transcription factor PqrA Proteus vulgaris
Q48413 1.39e-32 113 48 1 105 1 ramA Transcriptional activator RamA Klebsiella pneumoniae
A0A0H3GPK2 1.39e-32 113 48 1 105 1 ramA Transcriptional regulator RamA Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
H9L484 1e-31 111 48 2 111 1 ramA Transcriptional regulator RamA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZJU7 6.04e-31 114 52 1 101 2 rob Transcriptional regulator Rob Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0ACI2 1.26e-30 113 51 1 102 3 rob Right origin-binding protein Shigella flexneri
P0ACI0 1.26e-30 113 51 1 102 1 rob Right origin-binding protein Escherichia coli (strain K12)
P0ACI1 1.26e-30 113 51 1 102 3 rob Right origin-binding protein Escherichia coli O157:H7
P0A9E2 4.74e-30 107 43 1 103 1 soxS Regulatory protein SoxS Escherichia coli (strain K12)
P0A9E3 4.74e-30 107 43 1 103 3 soxS Regulatory protein SoxS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9E4 4.74e-30 107 43 1 103 3 soxS Regulatory protein SoxS Escherichia coli O157:H7
P55922 4.84e-30 107 45 1 105 4 ramA Transcriptional activator RamA Enterobacter cloacae
Q56143 7.93e-30 106 43 1 103 3 soxS Regulatory protein SoxS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P43463 1.19e-28 104 44 1 102 4 aarP HTH-type transcriptional activator AarP Providencia stuartii
P28816 1.01e-27 102 45 1 102 1 tetD Transposon Tn10 TetD protein Escherichia coli
P0ACH7 8.43e-27 99 41 1 101 3 marA Multiple antibiotic resistance protein MarA Shigella flexneri
P0ACH5 8.43e-27 99 41 1 101 1 marA Multiple antibiotic resistance protein MarA Escherichia coli (strain K12)
P0ACH6 8.43e-27 99 41 1 101 3 marA Multiple antibiotic resistance protein MarA Escherichia coli O157:H7
P0A2S4 9.72e-27 99 41 1 101 2 marA Multiple antibiotic resistance protein MarA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2S5 9.72e-27 99 41 1 101 3 marA Multiple antibiotic resistance protein MarA Salmonella typhi
P0A2S6 9.72e-27 99 41 1 101 3 marA Multiple antibiotic resistance protein MarA Salmonella enteritidis
P77601 5.03e-20 84 40 1 105 5 ykgA Putative HTH-type transcriptional regulator YkgA Escherichia coli (strain K12)
P96662 1.36e-14 71 33 1 104 4 ydeE Uncharacterized HTH-type transcriptional regulator YdeE Bacillus subtilis (strain 168)
O31456 1.14e-13 68 41 1 103 3 ybfP Uncharacterized HTH-type transcriptional regulator YbfP Bacillus subtilis (strain 168)
P19219 3.16e-13 66 36 0 92 1 adaA Bifunctional transcriptional activator/DNA repair enzyme AdaA Bacillus subtilis (strain 168)
P26950 6.18e-12 63 39 1 105 4 caf1R F1 operon positive regulatory protein Yersinia pestis
Q83PE0 1.31e-10 60 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Shigella flexneri
Q0SZ95 1.31e-10 60 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Shigella flexneri serotype 5b (strain 8401)
Q0TAF8 1.42e-10 60 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UNM6 1.42e-10 60 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3YV71 1.44e-10 60 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Shigella sonnei (strain Ss046)
Q31U84 1.45e-10 60 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Shigella boydii serotype 4 (strain Sb227)
P09377 1.45e-10 60 32 1 104 1 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12)
B1IVH3 1.45e-10 60 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A709 1.45e-10 60 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O9:H4 (strain HS)
B1XB72 1.45e-10 60 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12 / DH10B)
C5A073 1.45e-10 60 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6V7 1.45e-10 60 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O8 (strain IAI1)
B5YZ43 1.45e-10 60 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X897 1.45e-10 60 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O157:H7
B7L9G1 1.45e-10 60 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain 55989 / EAEC)
Q47129 1.5e-10 60 35 2 89 1 feaR Transcriptional activator FeaR Escherichia coli (strain K12)
B1LMU6 1.51e-10 59 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain SMS-3-5 / SECEC)
Q8CXW5 1.51e-10 59 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7N2P7 1.51e-10 59 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O81 (strain ED1a)
Q32A70 1.56e-10 59 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Shigella dysenteriae serotype 1 (strain Sd197)
Q1R414 1.59e-10 59 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain UTI89 / UPEC)
B7NFK3 1.59e-10 59 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A1AI82 1.59e-10 59 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O1:K1 / APEC
B7NUA1 1.59e-10 59 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MI37 1.59e-10 59 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O45:K1 (strain S88 / ExPEC)
Q5HJR8 2.86e-10 59 31 1 105 4 SACOL0084 Uncharacterized HTH-type transcriptional regulator SACOL0084 Staphylococcus aureus (strain COL)
Q6GD21 2.97e-10 59 31 1 105 4 SAS0078 Uncharacterized HTH-type transcriptional regulator SAS0078 Staphylococcus aureus (strain MSSA476)
Q8NYT6 2.97e-10 59 31 1 105 4 MW0077 Uncharacterized HTH-type transcriptional regulator MW0077 Staphylococcus aureus (strain MW2)
Q99XB1 3e-10 59 31 1 105 4 SAV0101 Uncharacterized HTH-type transcriptional regulator SAV0101 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A882 3e-10 59 31 1 105 4 SA0097 Uncharacterized HTH-type transcriptional regulator SA0097 Staphylococcus aureus (strain N315)
Q6GKK1 3.12e-10 59 31 1 105 4 SAR0107 Uncharacterized HTH-type transcriptional regulator SAR0107 Staphylococcus aureus (strain MRSA252)
B2TVP7 3.13e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P26993 3.79e-10 58 32 0 82 1 exsA HTH-type transcriptional regulator ExsA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P28808 4.54e-10 58 32 0 85 4 lcrF Thermoregulatory protein LcrF Yersinia pestis
P45008 4.68e-10 58 33 0 81 4 HI_1052 Uncharacterized HTH-type transcriptional regulator HI_1052 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0C2V5 4.97e-10 58 32 0 85 2 virF Virulence regulon transcriptional activator VirF Yersinia enterocolitica
A7ZUB7 5.01e-10 58 31 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O139:H28 (strain E24377A / ETEC)
B6I4P8 6e-10 58 31 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain SE11)
A8AL27 8.51e-10 57 31 1 104 3 rhaS HTH-type transcriptional activator RhaS Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
O87389 8.65e-10 58 32 1 97 4 glxA HTH-type transcriptional regulator GlxA Rhizobium meliloti (strain 1021)
A1JU91 1.06e-09 57 32 0 85 3 virF Virulence regulon transcriptional activator VirF Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q936F1 1.2e-09 57 31 1 105 4 None Uncharacterized HTH-type transcriptional regulator Staphylococcus aureus
A4WG91 1.28e-09 57 30 1 104 3 rhaS HTH-type transcriptional activator RhaS Enterobacter sp. (strain 638)
Q9HTI4 1.65e-09 57 28 1 112 1 gbdR HTH-type transcriptional regulator GbdR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0A0H2ZIC3 1.65e-09 57 28 1 112 1 gbdR HTH-type transcriptional regulator GbdR Pseudomonas aeruginosa (strain UCBPP-PA14)
Q00753 2.59e-09 56 27 1 108 4 msmR Msm operon regulatory protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
O31449 4.04e-09 55 33 1 84 4 ybfI Uncharacterized HTH-type transcriptional regulator YbfI Bacillus subtilis (strain 168)
P0ACI3 4.72e-09 55 33 0 86 1 xylR Xylose operon regulatory protein Escherichia coli (strain K12)
P0ACI4 4.72e-09 55 33 0 86 3 xylR Xylose operon regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACI5 4.72e-09 55 33 0 86 3 xylR Xylose operon regulatory protein Escherichia coli O157:H7
B5FPP5 1.32e-08 54 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella dublin (strain CT_02021853)
Q65Q30 1.38e-08 54 37 0 67 3 rhaR HTH-type transcriptional activator RhaR Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B4TPQ9 1.46e-08 54 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella schwarzengrund (strain CVM19633)
A9MI64 1.5e-08 54 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q57HG8 1.53e-08 54 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella choleraesuis (strain SC-B67)
P0A2S9 1.55e-08 54 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2T0 1.55e-08 54 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella typhi
C0Q3L4 1.55e-08 54 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi C (strain RKS4594)
A9MZC8 1.55e-08 54 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SZZ3 1.55e-08 54 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella newport (strain SL254)
B5RFC3 1.55e-08 54 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QWY4 1.55e-08 54 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella enteritidis PT4 (strain P125109)
B5BJG8 1.56e-08 54 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi A (strain AKU_12601)
Q5PKG2 1.56e-08 54 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TBY3 1.56e-08 54 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella heidelberg (strain SL476)
B5F0M9 1.64e-08 54 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella agona (strain SL483)
O33813 3.93e-08 53 27 1 98 4 lacR Lactose operon transcription activator Staphylococcus xylosus
Q8ZM00 5.02e-08 52 33 1 87 1 STM3175 Probable HTH-type transcriptional regulator STM3175 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q05587 5.64e-08 52 23 1 96 1 pocR Regulatory protein PocR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9WW32 8.07e-08 52 30 0 84 1 mtrA HTH-type transcriptional regulator MtrA Neisseria gonorrhoeae
B5XZ49 1.21e-07 51 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Klebsiella pneumoniae (strain 342)
P54722 1.9e-07 51 31 1 87 4 yfiF Uncharacterized HTH-type transcriptional regulator YfiF Bacillus subtilis (strain 168)
A6TGA9 1.93e-07 51 28 1 104 3 rhaS HTH-type transcriptional activator RhaS Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A9QYR8 2.46e-07 50 29 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis bv. Antiqua (strain Angola)
Q66FF2 2.58e-07 50 29 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype I (strain IP32953)
B1JNC5 2.61e-07 50 29 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TRS8 2.61e-07 50 29 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis (strain Pestoides F)
B2K1W5 2.61e-07 50 29 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FN80 2.61e-07 50 29 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q8FQS2 3.1e-07 50 34 1 85 3 ripA HTH-type transcriptional regulator RipA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P0ACH8 3.37e-07 50 28 0 90 1 melR Melibiose operon regulatory protein Escherichia coli (strain K12)
P0ACH9 3.37e-07 50 28 0 90 3 melR Melibiose operon regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q65Q31 1.06e-06 48 29 1 97 3 rhaS HTH-type transcriptional activator RhaS Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q1CEB5 1.38e-06 48 28 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZJ00 1.38e-06 48 28 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis
Q1C0W1 1.38e-06 48 28 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis bv. Antiqua (strain Antiqua)
O32071 1.39e-06 48 30 1 105 4 ytdP Uncharacterized HTH-type transcriptional regulator YtdP Bacillus subtilis (strain 168)
T2KMF4 3.55e-06 47 31 0 87 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
P35319 3.71e-06 47 28 0 84 4 None Putative AraC-like transcription regulator Streptomyces lividans
Q32A71 4.31e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Shigella dysenteriae serotype 1 (strain Sd197)
P07859 4.59e-06 47 29 2 97 4 xylS XylDLEGF operon transcriptional activator Pseudomonas putida
O31249 4.6e-06 47 28 0 81 4 alkR HTH-type transcriptional regulator AlkR Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q04710 4.77e-06 47 29 2 97 4 xylS1 XylDLEGF operon transcriptional activator 1 Pseudomonas putida
P09378 5.03e-06 47 25 1 104 1 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain K12)
A8A710 5.03e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O9:H4 (strain HS)
C5A074 5.03e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain K12 / MC4100 / BW2952)
Q83PD9 5.08e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Shigella flexneri
Q0SZ96 5.08e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Shigella flexneri serotype 5b (strain 8401)
Q1R413 5.08e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain UTI89 / UPEC)
A1AI83 5.08e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O1:K1 / APEC
Q8X7B3 5.18e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O157:H7
B4TPR0 5.34e-06 47 25 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella schwarzengrund (strain CVM19633)
P17410 5.37e-06 47 26 1 109 1 chbR HTH-type transcriptional regulator ChbR Escherichia coli (strain K12)
Q31U83 5.44e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Shigella boydii serotype 4 (strain Sb227)
Q8FBD7 5.44e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAF7 5.44e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZUB8 5.44e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O139:H28 (strain E24377A / ETEC)
O31522 7.69e-06 47 29 1 87 2 yesS HTH-type transcriptional regulator YesS Bacillus subtilis (strain 168)
P43461 1.53e-05 45 32 1 83 4 None Uncharacterized HTH-type transcriptional regulator in cgkA 5'region (Fragment) Pseudoalteromonas carrageenovora
Q8NRR3 1.57e-05 45 33 1 81 2 ripA HTH-type transcriptional regulator RipA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
G3XCU2 2.02e-05 45 32 0 87 4 argR HTH-type transcriptional regulator ArgR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B5FPP6 2.05e-05 45 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella dublin (strain CT_02021853)
P95283 2.05e-05 45 28 0 81 2 Rv1931c HTH-type transcriptional regulator Rv1931c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A6TGB0 2.19e-05 45 27 0 81 3 rhaR HTH-type transcriptional activator RhaR Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P45043 2.67e-05 45 30 0 83 3 xylR Xylose operon regulatory protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C6DJR5 2.67e-05 45 27 0 83 3 rhaR HTH-type transcriptional activator RhaR Pectobacterium carotovorum subsp. carotovorum (strain PC1)
P40408 2.75e-05 45 24 1 103 1 btr HTH-type transcriptional activator Btr Bacillus subtilis (strain 168)
P0CL08 3.15e-05 45 32 1 81 4 hilD Transcriptional regulator HilD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WAC0 3.15e-05 45 32 1 81 4 hilD Transcriptional regulator HilD Salmonella typhimurium (strain SL1344)
Q6DA21 4.13e-05 44 26 0 83 3 rhaR HTH-type transcriptional activator RhaR Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P40865 6.76e-05 43 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BJG9 6.76e-05 43 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella paratyphi A (strain AKU_12601)
A9MZC9 6.76e-05 43 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKG1 6.76e-05 43 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SZZ4 6.76e-05 43 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella newport (strain SL254)
B5QWY5 6.76e-05 43 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella enteritidis PT4 (strain P125109)
B5F0N0 6.83e-05 43 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella agona (strain SL483)
P43464 6.9e-05 43 33 1 77 4 aggR Transcriptional activator AggR Escherichia coli
A9MI63 7.1e-05 43 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4WG90 7.67e-05 43 22 1 103 3 rhaR HTH-type transcriptional activator RhaR Enterobacter sp. (strain 638)
Q46855 8.96e-05 43 23 1 100 4 yqhC Uncharacterized HTH-type transcriptional regulator YqhC Escherichia coli (strain K12)
Q57HG7 9.4e-05 43 23 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella choleraesuis (strain SC-B67)
Q8Z2V5 9.96e-05 43 23 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella typhi
B4TBY4 9.96e-05 43 23 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella heidelberg (strain SL476)
B1Q2A8 0.000119 43 27 1 83 1 nphR Transcriptional activator NphR Rhodococcus sp.
Q66FF1 0.000136 43 29 2 94 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FN79 0.000136 43 29 2 94 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P07642 0.000136 43 26 0 83 3 araC Arabinose operon regulatory protein Dickeya chrysanthemi
A4TRS7 0.000137 43 29 2 94 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis (strain Pestoides F)
Q1CEB6 0.000137 43 29 2 94 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYR6 0.000137 43 29 2 94 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIZ9 0.000137 43 29 2 94 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis
B2K1W6 0.000137 43 29 2 94 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0W2 0.000137 43 29 2 94 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Antiqua)
B1JNC4 0.000144 43 27 1 93 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q9HTH5 0.00015 43 28 1 84 1 cdhR HTH-type transcriptional regulator CdhR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P43459 0.000157 42 26 3 115 4 perA Transcriptional activator PerA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ML57 0.000177 42 29 0 67 3 rhaR HTH-type transcriptional activator RhaR Cronobacter sakazakii (strain ATCC BAA-894)
P77396 0.000201 42 27 0 79 4 ypdC Uncharacterized HTH-type transcriptional regulator YpdC Escherichia coli (strain K12)
O31517 0.000287 42 34 2 70 3 yesN Uncharacterized transcriptional regulatory protein YesN Bacillus subtilis (strain 168)
P32677 0.000605 41 26 1 89 4 yijO Uncharacterized HTH-type transcriptional regulator YijO Escherichia coli (strain K12)
P03022 0.000652 41 25 1 103 3 araC Arabinose operon regulatory protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P11765 0.001 40 25 1 100 3 araC Arabinose operon regulatory protein Citrobacter freundii

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_13325
Feature type CDS
Gene araC
Product AraC-type DNA-binding domain and AraC-containing proteins
Location 43161 - 43529 (strand: 1)
Length 369 (nucleotides) / 122 (amino acids)

Contig

Accession contig_16
Length 109220 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_34
Orthogroup size 15
N. genomes 7

Actions

Genomic region

Domains

PF12833 Helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2207 Transcription (K) K AraC-type DNA-binding domain and AraC-containing proteins

Protein Sequence

MSESVVNDIIKWLETQLQRNEGIKIDTIADKSGYSKWHLQRIFKDIKGCTLGEYVRKRRLLEAAKSLRDNDMSILDIALQYGFSSQATFTRIFKKHFNTTPAKFRDHGQLPEPRCFMECGSH

Flanking regions ( +/- flanking 50bp)

ATGTGACTATTAGAATTTATAGATTGTAAGCCCGATTTTGGGAGGTGAACATGTCAGAAAGTGTAGTGAACGATATTATCAAATGGCTGGAAACCCAGTTACAGCGCAATGAAGGGATCAAGATTGATACTATTGCGGATAAGAGCGGTTATTCAAAATGGCATCTCCAGCGTATTTTCAAAGATATCAAGGGATGCACATTAGGTGAGTATGTCCGTAAGCGCCGCCTGCTGGAAGCAGCAAAATCTCTGCGCGATAACGATATGTCTATTCTGGATATCGCGTTGCAGTATGGCTTCAGCTCACAGGCAACCTTTACCCGCATCTTTAAAAAACATTTCAATACCACACCGGCAAAATTCCGTGATCACGGTCAGTTGCCGGAACCGCGCTGTTTTATGGAGTGCGGTTCACACTAAACAGCTGAAAAAATATCCCCGCCTGCCGCAACCGGCCAAACGGGGATATT