Homologs in group_34

Help

14 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13325 FBDBKF_13325 92.6 Morganella morganii S1 araC AraC-type DNA-binding domain and AraC-containing proteins
EHELCC_08770 EHELCC_08770 92.6 Morganella morganii S2 araC AraC-type DNA-binding domain and AraC-containing proteins
NLDBIP_09095 NLDBIP_09095 92.6 Morganella morganii S4 araC AraC-type DNA-binding domain and AraC-containing proteins
LHKJJB_05170 LHKJJB_05170 92.6 Morganella morganii S3 araC AraC-type DNA-binding domain and AraC-containing proteins
HKOGLL_05745 HKOGLL_05745 92.6 Morganella morganii S5 araC AraC-type DNA-binding domain and AraC-containing proteins
F4V73_RS01705 F4V73_RS01705 37.0 Morganella psychrotolerans - AraC family transcriptional regulator
F4V73_RS04165 F4V73_RS04165 25.2 Morganella psychrotolerans - AraC family transcriptional regulator
F4V73_RS04870 F4V73_RS04870 27.1 Morganella psychrotolerans - AraC family transcriptional regulator
F4V73_RS12525 F4V73_RS12525 32.1 Morganella psychrotolerans - AraC family transcriptional regulator
F4V73_RS17025 F4V73_RS17025 45.5 Morganella psychrotolerans - helix-turn-helix domain-containing protein
PMI_RS04495 PMI_RS04495 28.3 Proteus mirabilis HI4320 - helix-turn-helix domain-containing protein
PMI_RS05115 PMI_RS05115 84.4 Proteus mirabilis HI4320 - helix-turn-helix domain-containing protein
PMI_RS14600 PMI_RS14600 33.3 Proteus mirabilis HI4320 chbR transcriptional regulator ChbR
PMI_RS18315 PMI_RS18315 28.4 Proteus mirabilis HI4320 - AraC family transcriptional regulator

Distribution of the homologs in the orthogroup group_34

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_34

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q52620 1.97e-74 219 85 0 119 4 pqrA Probable transcription factor PqrA Proteus vulgaris
Q48413 3.11e-32 112 47 1 105 1 ramA Transcriptional activator RamA Klebsiella pneumoniae
A0A0H3GPK2 3.11e-32 112 47 1 105 1 ramA Transcriptional regulator RamA Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
Q8ZJU7 3.39e-31 115 50 1 106 2 rob Transcriptional regulator Rob Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
H9L484 3.44e-31 110 48 1 105 1 ramA Transcriptional regulator RamA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0ACI2 8.05e-31 114 51 1 102 3 rob Right origin-binding protein Shigella flexneri
P0ACI0 8.05e-31 114 51 1 102 1 rob Right origin-binding protein Escherichia coli (strain K12)
P0ACI1 8.05e-31 114 51 1 102 3 rob Right origin-binding protein Escherichia coli O157:H7
P0A9E2 5.71e-30 106 43 1 103 1 soxS Regulatory protein SoxS Escherichia coli (strain K12)
P0A9E3 5.71e-30 106 43 1 103 3 soxS Regulatory protein SoxS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9E4 5.71e-30 106 43 1 103 3 soxS Regulatory protein SoxS Escherichia coli O157:H7
Q56143 9.55e-30 106 43 1 103 3 soxS Regulatory protein SoxS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P55922 1.11e-29 106 44 1 105 4 ramA Transcriptional activator RamA Enterobacter cloacae
P43463 1.58e-29 106 45 1 102 4 aarP HTH-type transcriptional activator AarP Providencia stuartii
P28816 2.89e-28 103 45 1 104 1 tetD Transposon Tn10 TetD protein Escherichia coli
P0ACH7 9.65e-28 101 42 1 101 3 marA Multiple antibiotic resistance protein MarA Shigella flexneri
P0ACH5 9.65e-28 101 42 1 101 1 marA Multiple antibiotic resistance protein MarA Escherichia coli (strain K12)
P0ACH6 9.65e-28 101 42 1 101 3 marA Multiple antibiotic resistance protein MarA Escherichia coli O157:H7
P0A2S4 1.11e-27 101 42 1 101 2 marA Multiple antibiotic resistance protein MarA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2S5 1.11e-27 101 42 1 101 3 marA Multiple antibiotic resistance protein MarA Salmonella typhi
P0A2S6 1.11e-27 101 42 1 101 3 marA Multiple antibiotic resistance protein MarA Salmonella enteritidis
P77601 2.53e-20 85 40 1 105 5 ykgA Putative HTH-type transcriptional regulator YkgA Escherichia coli (strain K12)
P96662 8.63e-16 74 35 1 104 4 ydeE Uncharacterized HTH-type transcriptional regulator YdeE Bacillus subtilis (strain 168)
P19219 1.38e-14 70 38 0 93 1 adaA Bifunctional transcriptional activator/DNA repair enzyme AdaA Bacillus subtilis (strain 168)
O31456 4.03e-13 67 40 1 103 3 ybfP Uncharacterized HTH-type transcriptional regulator YbfP Bacillus subtilis (strain 168)
P26950 6.43e-12 63 39 1 105 4 caf1R F1 operon positive regulatory protein Yersinia pestis
Q83PE0 4.23e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Shigella flexneri
Q0SZ95 4.23e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Shigella flexneri serotype 5b (strain 8401)
B5YZ43 4.32e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X897 4.32e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O157:H7
Q47129 4.51e-10 58 34 2 89 1 feaR Transcriptional activator FeaR Escherichia coli (strain K12)
Q32A70 4.82e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Shigella dysenteriae serotype 1 (strain Sd197)
Q8CXW5 4.82e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0C2V5 4.82e-10 58 32 0 85 2 virF Virulence regulon transcriptional activator VirF Yersinia enterocolitica
P28808 4.92e-10 58 32 0 85 4 lcrF Thermoregulatory protein LcrF Yersinia pestis
B7N2P7 5.01e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O81 (strain ED1a)
Q0TAF8 5.06e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UNM6 5.06e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1LMU6 5.11e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain SMS-3-5 / SECEC)
Q31U84 5.17e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Shigella boydii serotype 4 (strain Sb227)
P09377 5.17e-10 58 32 1 104 1 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12)
B1IVH3 5.17e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A709 5.17e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O9:H4 (strain HS)
B1XB72 5.17e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12 / DH10B)
C5A073 5.17e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6V7 5.17e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O8 (strain IAI1)
B7L9G1 5.17e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain 55989 / EAEC)
Q3YV71 5.22e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Shigella sonnei (strain Ss046)
Q1R414 5.43e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain UTI89 / UPEC)
B7NFK3 5.43e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A1AI82 5.43e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O1:K1 / APEC
B7NUA1 5.43e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MI37 5.43e-10 58 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O45:K1 (strain S88 / ExPEC)
P45008 5.54e-10 58 33 0 81 4 HI_1052 Uncharacterized HTH-type transcriptional regulator HI_1052 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5HJR8 7.83e-10 58 30 1 105 4 SACOL0084 Uncharacterized HTH-type transcriptional regulator SACOL0084 Staphylococcus aureus (strain COL)
Q99XB1 9.06e-10 58 30 1 105 4 SAV0101 Uncharacterized HTH-type transcriptional regulator SAV0101 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A882 9.06e-10 58 30 1 105 4 SA0097 Uncharacterized HTH-type transcriptional regulator SA0097 Staphylococcus aureus (strain N315)
B2TVP7 9.49e-10 57 32 1 104 3 rhaS HTH-type transcriptional activator RhaS Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A1JU91 9.72e-10 57 32 0 85 3 virF Virulence regulon transcriptional activator VirF Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6GKK1 9.79e-10 58 30 1 105 4 SAR0107 Uncharacterized HTH-type transcriptional regulator SAR0107 Staphylococcus aureus (strain MRSA252)
Q6GD21 9.98e-10 58 30 1 105 4 SAS0078 Uncharacterized HTH-type transcriptional regulator SAS0078 Staphylococcus aureus (strain MSSA476)
Q8NYT6 9.98e-10 58 30 1 105 4 MW0077 Uncharacterized HTH-type transcriptional regulator MW0077 Staphylococcus aureus (strain MW2)
O87389 1.15e-09 57 32 1 97 4 glxA HTH-type transcriptional regulator GlxA Rhizobium meliloti (strain 1021)
A7ZUB7 1.78e-09 57 31 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O139:H28 (strain E24377A / ETEC)
P26993 1.89e-09 57 30 0 84 1 exsA HTH-type transcriptional regulator ExsA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B6I4P8 2.19e-09 56 31 1 104 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain SE11)
P0ACI3 2.82e-09 56 33 0 86 1 xylR Xylose operon regulatory protein Escherichia coli (strain K12)
P0ACI4 2.82e-09 56 33 0 86 3 xylR Xylose operon regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACI5 2.82e-09 56 33 0 86 3 xylR Xylose operon regulatory protein Escherichia coli O157:H7
Q936F1 3.62e-09 56 30 1 105 4 None Uncharacterized HTH-type transcriptional regulator Staphylococcus aureus
O31449 3.7e-09 55 31 2 99 4 ybfI Uncharacterized HTH-type transcriptional regulator YbfI Bacillus subtilis (strain 168)
A8AL27 5.74e-09 55 30 1 104 3 rhaS HTH-type transcriptional activator RhaS Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q00753 7.29e-09 55 27 1 104 4 msmR Msm operon regulatory protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A4WG91 1e-08 54 31 1 100 3 rhaS HTH-type transcriptional activator RhaS Enterobacter sp. (strain 638)
Q9HTI4 1.29e-08 54 29 2 104 1 gbdR HTH-type transcriptional regulator GbdR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0A0H2ZIC3 1.29e-08 54 29 2 104 1 gbdR HTH-type transcriptional regulator GbdR Pseudomonas aeruginosa (strain UCBPP-PA14)
Q65Q30 1.46e-08 54 37 0 67 3 rhaR HTH-type transcriptional activator RhaR Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P54722 5.03e-08 53 32 1 87 4 yfiF Uncharacterized HTH-type transcriptional regulator YfiF Bacillus subtilis (strain 168)
Q8ZM00 7.67e-08 52 32 1 89 1 STM3175 Probable HTH-type transcriptional regulator STM3175 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5FPP5 8.8e-08 52 27 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella dublin (strain CT_02021853)
B4TPQ9 9.33e-08 52 27 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella schwarzengrund (strain CVM19633)
A9MI64 9.71e-08 52 27 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q9WW32 9.72e-08 52 30 0 84 1 mtrA HTH-type transcriptional regulator MtrA Neisseria gonorrhoeae
P0A2S9 1.01e-07 52 27 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2T0 1.01e-07 52 27 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella typhi
C0Q3L4 1.01e-07 52 27 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi C (strain RKS4594)
A9MZC8 1.01e-07 52 27 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SZZ3 1.01e-07 52 27 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella newport (strain SL254)
B5RFC3 1.01e-07 52 27 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QWY4 1.01e-07 52 27 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella enteritidis PT4 (strain P125109)
B4TBY3 1.04e-07 52 27 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella heidelberg (strain SL476)
B5BJG8 1.06e-07 52 27 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi A (strain AKU_12601)
Q5PKG2 1.06e-07 52 27 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57HG8 1.06e-07 52 27 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella choleraesuis (strain SC-B67)
B5F0M9 1.07e-07 52 27 1 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella agona (strain SL483)
O33813 2.45e-07 50 26 1 98 4 lacR Lactose operon transcription activator Staphylococcus xylosus
Q05587 3.38e-07 50 22 1 96 1 pocR Regulatory protein PocR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5XZ49 7.79e-07 49 29 1 100 3 rhaS HTH-type transcriptional activator RhaS Klebsiella pneumoniae (strain 342)
Q8FQS2 1.07e-06 49 32 1 85 3 ripA HTH-type transcriptional regulator RipA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A6TGA9 1.19e-06 48 29 1 100 3 rhaS HTH-type transcriptional activator RhaS Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P17410 1.78e-06 48 27 1 109 1 chbR HTH-type transcriptional regulator ChbR Escherichia coli (strain K12)
Q66FF2 1.95e-06 48 28 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype I (strain IP32953)
B1JNC5 2.11e-06 48 28 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TRS8 2.11e-06 48 28 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis (strain Pestoides F)
B2K1W5 2.11e-06 48 28 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FN80 2.11e-06 48 28 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A9QYR8 2.15e-06 48 28 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis bv. Antiqua (strain Angola)
O31522 2.32e-06 48 31 1 87 2 yesS HTH-type transcriptional regulator YesS Bacillus subtilis (strain 168)
Q65Q31 2.91e-06 47 29 1 97 3 rhaS HTH-type transcriptional activator RhaS Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q32A71 3.68e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Shigella dysenteriae serotype 1 (strain Sd197)
Q1R413 3.95e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain UTI89 / UPEC)
A1AI83 3.95e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O1:K1 / APEC
Q31U83 4.1e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Shigella boydii serotype 4 (strain Sb227)
Q8FBD7 4.1e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAF7 4.1e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZUB8 4.1e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O139:H28 (strain E24377A / ETEC)
P09378 4.14e-06 47 25 1 104 1 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain K12)
A8A710 4.14e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O9:H4 (strain HS)
C5A074 4.14e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain K12 / MC4100 / BW2952)
P0ACH8 4.24e-06 47 27 0 90 1 melR Melibiose operon regulatory protein Escherichia coli (strain K12)
P0ACH9 4.24e-06 47 27 0 90 3 melR Melibiose operon regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X7B3 4.27e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O157:H7
Q83PD9 4.48e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Shigella flexneri
Q0SZ96 4.48e-06 47 25 1 104 3 rhaR HTH-type transcriptional activator RhaR Shigella flexneri serotype 5b (strain 8401)
O31249 4.56e-06 47 28 0 81 4 alkR HTH-type transcriptional regulator AlkR Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
O32071 4.57e-06 47 29 1 105 4 ytdP Uncharacterized HTH-type transcriptional regulator YtdP Bacillus subtilis (strain 168)
T2KMF4 5.38e-06 47 31 0 87 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
B4TPR0 5.6e-06 47 25 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella schwarzengrund (strain CVM19633)
P40408 5.85e-06 47 25 1 103 1 btr HTH-type transcriptional activator Btr Bacillus subtilis (strain 168)
P35319 7.39e-06 46 28 0 84 4 None Putative AraC-like transcription regulator Streptomyces lividans
Q04710 1.01e-05 46 29 2 97 4 xylS1 XylDLEGF operon transcriptional activator 1 Pseudomonas putida
P0CL08 1.02e-05 46 33 1 81 4 hilD Transcriptional regulator HilD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WAC0 1.02e-05 46 33 1 81 4 hilD Transcriptional regulator HilD Salmonella typhimurium (strain SL1344)
P07859 1.03e-05 46 29 2 97 4 xylS XylDLEGF operon transcriptional activator Pseudomonas putida
Q1CEB5 1.05e-05 46 27 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZJ00 1.05e-05 46 27 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis
Q1C0W1 1.05e-05 46 27 1 103 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis bv. Antiqua (strain Antiqua)
P95283 1.12e-05 46 28 0 81 2 Rv1931c HTH-type transcriptional regulator Rv1931c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
C6DJR5 1.84e-05 45 27 0 83 3 rhaR HTH-type transcriptional activator RhaR Pectobacterium carotovorum subsp. carotovorum (strain PC1)
G3XCU2 2.08e-05 45 31 0 88 4 argR HTH-type transcriptional regulator ArgR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B5FPP6 2.46e-05 45 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella dublin (strain CT_02021853)
A6TGB0 2.82e-05 45 27 0 81 3 rhaR HTH-type transcriptional activator RhaR Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q6DA21 3.27e-05 45 26 0 82 3 rhaR HTH-type transcriptional activator RhaR Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P45043 3.67e-05 44 29 0 85 3 xylR Xylose operon regulatory protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P43461 4.46e-05 43 32 1 83 4 None Uncharacterized HTH-type transcriptional regulator in cgkA 5'region (Fragment) Pseudoalteromonas carrageenovora
P43464 5.3e-05 44 40 0 55 4 aggR Transcriptional activator AggR Escherichia coli
B5F0N0 6.44e-05 43 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella agona (strain SL483)
Q8NRR3 6.45e-05 44 32 2 87 2 ripA HTH-type transcriptional regulator RipA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P40865 6.69e-05 43 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BJG9 6.69e-05 43 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella paratyphi A (strain AKU_12601)
A9MZC9 6.69e-05 43 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKG1 6.69e-05 43 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SZZ4 6.69e-05 43 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella newport (strain SL254)
B5QWY5 6.69e-05 43 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella enteritidis PT4 (strain P125109)
A9MI63 6.96e-05 43 24 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q46855 9.59e-05 43 23 1 100 4 yqhC Uncharacterized HTH-type transcriptional regulator YqhC Escherichia coli (strain K12)
Q57HG7 9.77e-05 43 23 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella choleraesuis (strain SC-B67)
Q8Z2V5 9.87e-05 43 23 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella typhi
B4TBY4 9.87e-05 43 23 1 103 3 rhaR HTH-type transcriptional activator RhaR Salmonella heidelberg (strain SL476)
A4WG90 0.000108 43 22 1 103 3 rhaR HTH-type transcriptional activator RhaR Enterobacter sp. (strain 638)
P77396 0.000129 43 27 0 79 4 ypdC Uncharacterized HTH-type transcriptional regulator YpdC Escherichia coli (strain K12)
A7ML57 0.00016 42 29 0 67 3 rhaR HTH-type transcriptional activator RhaR Cronobacter sakazakii (strain ATCC BAA-894)
P07642 0.000184 42 26 0 83 3 araC Arabinose operon regulatory protein Dickeya chrysanthemi
A4TRS7 0.000278 42 31 0 67 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis (strain Pestoides F)
Q1CEB6 0.000278 42 31 0 67 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYR6 0.000278 42 31 0 67 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIZ9 0.000278 42 31 0 67 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis
B2K1W6 0.000278 42 31 0 67 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0W2 0.000278 42 31 0 67 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Antiqua)
B1JNC4 0.000287 42 31 0 67 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FF1 0.000289 42 31 0 67 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FN79 0.000289 42 31 0 67 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P32326 0.000454 41 28 1 83 4 ureR Urease operon transcriptional activator Escherichia coli
P03022 0.000522 41 25 1 103 3 araC Arabinose operon regulatory protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P11765 0.000776 40 25 1 100 3 araC Arabinose operon regulatory protein Citrobacter freundii
Q9HTH5 0.000854 40 27 1 84 1 cdhR HTH-type transcriptional regulator CdhR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03430
Feature type CDS
Gene -
Product helix-turn-helix domain-containing protein
Location 731923 - 732291 (strand: -1)
Length 369 (nucleotides) / 122 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_34
Orthogroup size 15
N. genomes 7

Actions

Genomic region

Domains

PF12833 Helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2207 Transcription (K) K AraC-type DNA-binding domain and AraC-containing proteins

Protein Sequence

MSESVVNDIIKWLETQLQRNEGIKIDTIADKSGYSKWHLQRIFKDIKGCTLGEYVRKRRLLEAAKSLRDNNMSILDIALQYGFSSQATFTRIFKKHFNTTPAKFRDNGQLPETKRFMDCRAF

Flanking regions ( +/- flanking 50bp)

ATATATCGATAACCAAAATTTATTTTGTAAGCCCGCTTTGGGAGGCAAACATGTCAGAGAGCGTAGTGAACGACATCATCAAATGGCTGGAAACCCAGTTACAGCGTAATGAAGGGATTAAAATCGATACTATTGCGGATAAAAGTGGTTATTCAAAATGGCATCTTCAGCGTATTTTTAAAGATATTAAGGGATGTACGTTAGGCGAGTACGTCCGCAAACGCCGCTTGCTGGAAGCCGCGAAGTCCCTGCGTGACAACAACATGTCAATTCTGGACATCGCGTTACAGTATGGTTTCAGCTCACAGGCAACATTTACCCGGATCTTTAAAAAGCATTTCAATACTACCCCGGCAAAATTCCGCGATAATGGTCAGCTCCCGGAAACAAAACGTTTTATGGATTGCCGCGCATTCTGAAAGACCGAAAATATCCCCGTCCGCCACTGAGCGACAAACGGGGATATTTT