Homologs in group_250

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03365 FBDBKF_03365 47.2 Morganella morganii S1 accC acetyl-CoA carboxylase biotin carboxylase subunit
EHELCC_07170 EHELCC_07170 47.2 Morganella morganii S2 accC acetyl-CoA carboxylase biotin carboxylase subunit
NLDBIP_07495 NLDBIP_07495 47.2 Morganella morganii S4 accC acetyl-CoA carboxylase biotin carboxylase subunit
LHKJJB_07030 LHKJJB_07030 47.2 Morganella morganii S3 accC acetyl-CoA carboxylase biotin carboxylase subunit
HKOGLL_03900 HKOGLL_03900 47.2 Morganella morganii S5 accC acetyl-CoA carboxylase biotin carboxylase subunit
F4V73_RS11565 F4V73_RS11565 47.2 Morganella psychrotolerans accC acetyl-CoA carboxylase biotin carboxylase subunit
PMI_RS18045 PMI_RS18045 46.1 Proteus mirabilis HI4320 accC acetyl-CoA carboxylase biotin carboxylase subunit

Distribution of the homologs in the orthogroup group_250

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_250

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P46392 0.0 601 54 5 588 3 bccA Biotin-dependent acyl-coenzyme A carboxylase alpha3 subunit Mycobacterium leprae (strain TN)
P96890 0.0 592 56 6 588 1 accA3 Biotin-dependent acyl-coenzyme A carboxylase alpha3 subunit Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
I3R7G3 3.85e-144 432 43 10 581 1 pccA Propionyl-CoA carboxylase, biotin carboxylase and biotin-carboxyl carrier subunit Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
Q58626 2.92e-138 414 47 3 445 1 pycA Pyruvate carboxylase subunit A Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O27939 9.45e-136 407 43 5 491 1 pycA Pyruvate carboxylase subunit A Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q06862 1.18e-135 405 46 2 440 3 accC Biotin carboxylase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
O04983 4.02e-131 397 46 2 439 1 CAC2 Biotin carboxylase, chloroplastic Arabidopsis thaliana
B9HBA8 1.11e-128 390 46 2 439 2 POPTRDRAFT_831870 Biotin carboxylase 1, chloroplastic Populus trichocarpa
Q9KDS9 1.96e-126 382 45 5 430 3 accC Biotin carboxylase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B9N843 1.47e-125 382 45 2 439 2 POPTR_0018s14250g Biotin carboxylase 2, chloroplastic Populus trichocarpa
O30019 2.69e-124 378 41 9 501 3 pycA Pyruvate carboxylase subunit A Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P49787 6.02e-124 375 43 3 442 3 accC1 Biotin carboxylase 1 Bacillus subtilis (strain 168)
O52058 2.25e-119 363 45 4 430 3 accC Biotin carboxylase Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
P43873 1.25e-118 362 47 4 429 1 accC Biotin carboxylase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q96RQ3 2.55e-118 370 42 4 453 1 MCCC1 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Homo sapiens
O17732 4.03e-117 377 46 5 452 1 pyc-1 Pyruvate carboxylase 1 Caenorhabditis elegans
Q99MR8 4.16e-117 366 43 4 441 1 Mccc1 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Mus musculus
P37798 2.04e-116 356 43 5 448 1 accC Biotin carboxylase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O34544 2.7e-116 355 44 2 418 3 accC2 Biotin carboxylase 2 Bacillus subtilis (strain 168)
Q54KE6 6.11e-116 363 42 3 431 3 mccA Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Dictyostelium discoideum
D3DJ42 6.89e-116 355 42 3 440 1 cfiB 2-oxoglutarate carboxylase small subunit Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)
P9WPQ3 1.39e-115 360 45 2 424 1 accA1 Biotin-dependent 3-methylcrotonyl-coenzyme A carboxylase alpha1 subunit Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPQ2 1.39e-115 360 45 2 424 3 accA1 Biotin-dependent 3-methylcrotonyl-coenzyme A carboxylase alpha1 subunit Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A509 1.39e-115 360 45 2 424 3 accA1 Biotin-dependent 3-methylcrotonyl-coenzyme A carboxylase alpha1 subunit Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q5I0C3 4.6e-115 361 42 4 441 1 Mccc1 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Rattus norvegicus
Q42523 3.2e-114 359 40 7 494 1 MCCA Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Arabidopsis thaliana
P24182 6.75e-113 347 45 4 429 1 accC Biotin carboxylase Escherichia coli (strain K12)
Q8X9B6 1.34e-112 346 45 4 429 3 accC Biotin carboxylase Escherichia coli O157:H7
Q29RK2 1.57e-112 365 42 4 447 2 PC Pyruvate carboxylase, mitochondrial Bos taurus
Q2QMG2 1.97e-112 355 44 5 443 2 MCCA Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Oryza sativa subsp. japonica
Q2QMG2 0.000541 46 37 2 79 2 MCCA Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Oryza sativa subsp. japonica
Q05920 4.59e-112 364 42 4 447 1 Pc Pyruvate carboxylase, mitochondrial Mus musculus
P52873 5.7e-112 363 42 4 447 1 Pc Pyruvate carboxylase, mitochondrial Rattus norvegicus
Q5LUF3 1.9e-111 350 41 3 450 1 pccA Propionyl-CoA carboxylase alpha chain Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
P11498 2.27e-111 362 42 4 447 1 PC Pyruvate carboxylase, mitochondrial Homo sapiens
Q42777 2.26e-110 349 42 5 447 1 MCCA Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Glycine max
P32327 2.7e-108 354 44 5 447 1 PYC2 Pyruvate carboxylase 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P0DTA4 2.78e-107 341 39 4 449 1 PCCA Propionyl-CoA carboxylase alpha chain, mitochondrial Sus scrofa
Q91ZA3 1.03e-106 339 39 4 454 1 Pcca Propionyl-CoA carboxylase alpha chain, mitochondrial Mus musculus
Q9KWU4 2.9e-106 348 41 5 442 1 pyc Pyruvate carboxylase Bacillus subtilis (strain 168)
Q19842 2.16e-105 336 40 3 430 1 pcca-1 Propionyl-CoA carboxylase alpha chain, mitochondrial Caenorhabditis elegans
P05165 9.76e-105 334 40 3 431 1 PCCA Propionyl-CoA carboxylase alpha chain, mitochondrial Homo sapiens
Q612F5 5.77e-104 333 40 4 431 3 pcca-1 Propionyl-CoA carboxylase alpha chain, mitochondrial Caenorhabditis briggsae
P11154 3.3e-103 340 44 5 447 1 PYC1 Pyruvate carboxylase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9HES8 4.4e-103 340 42 5 445 3 pyc Pyruvate carboxylase Aspergillus niger
P14882 1.69e-102 329 39 4 454 1 Pcca Propionyl-CoA carboxylase alpha chain, mitochondrial Rattus norvegicus
Q8X1T3 2.86e-102 337 43 4 437 3 PYC Pyruvate carboxylase Pichia angusta
O93918 6.35e-102 337 42 5 445 2 pyc Pyruvate carboxylase Aspergillus terreus
Q0CLK1 7.4e-102 337 42 5 445 3 pyc Pyruvate carboxylase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q9UUE1 2.84e-101 335 42 5 437 3 pyr1 Pyruvate carboxylase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A0A0H3JRU9 4.36e-101 334 39 5 448 1 pycA Pyruvate carboxylase Staphylococcus aureus (strain Mu50 / ATCC 700699)
P78992 5.09e-99 329 42 4 437 3 PYC1 Pyruvate carboxylase Komagataella pastoris
P32528 5.85e-92 313 39 7 458 1 DUR1,2 Urea amidolyase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A5H0J2 3.65e-91 311 41 4 422 3 DUR1,2 Urea amidolyase Lachancea kluyveri
P38095 2.53e-84 289 37 5 439 2 lamA Putative urea carboxylase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B9FK36 4.85e-63 229 29 9 510 3 ACC2 Acetyl-CoA carboxylase 2 Oryza sativa subsp. japonica
Q38970 3.67e-62 226 28 8 512 1 ACC1 Acetyl-CoA carboxylase 1 Arabidopsis thaliana
Q8S6N5 4.66e-62 226 29 9 507 3 ACC1 Acetyl-CoA carboxylase 1 Oryza sativa subsp. japonica
F4I1L3 8.83e-62 225 28 8 512 2 ACC2 Acetyl-CoA carboxylase 2 Arabidopsis thaliana
P11029 3.22e-60 220 29 9 512 1 ACAC Acetyl-CoA carboxylase Gallus gallus
Q54J08 4.72e-60 220 29 9 499 3 accA Acetyl-CoA carboxylase Dictyostelium discoideum
B3LM95 3.26e-59 217 29 10 503 3 HFA1 Acetyl-CoA carboxylase, mitochondrial Saccharomyces cerevisiae (strain RM11-1a)
C8ZF72 4.7e-59 217 29 10 503 3 HFA1 Acetyl-CoA carboxylase, mitochondrial Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse)
C7GRE4 6.47e-59 216 29 10 503 3 HFA1 Acetyl-CoA carboxylase, mitochondrial Saccharomyces cerevisiae (strain JAY291)
A6ZMR9 7.59e-59 216 29 10 503 3 HFA1 Acetyl-CoA carboxylase, mitochondrial Saccharomyces cerevisiae (strain YJM789)
P32874 8.34e-59 216 29 10 503 1 HFA1 Acetyl-CoA carboxylase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q5SWU9 4.81e-58 214 28 8 512 1 Acaca Acetyl-CoA carboxylase 1 Mus musculus
Q28559 7.07e-58 213 28 7 512 2 ACACA Acetyl-CoA carboxylase 1 Ovis aries
Q13085 8.86e-58 213 28 7 512 1 ACACA Acetyl-CoA carboxylase 1 Homo sapiens
Q9TTS3 1.33e-57 213 28 7 512 2 ACACA Acetyl-CoA carboxylase 1 Bos taurus
Q00955 1.43e-56 209 29 12 511 1 ACC1 Acetyl-CoA carboxylase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O00763 1.15e-55 207 28 8 505 1 ACACB Acetyl-CoA carboxylase 2 Homo sapiens
P11497 1.33e-55 207 28 8 512 1 Acaca Acetyl-CoA carboxylase 1 Rattus norvegicus
E9Q4Z2 4.17e-55 205 28 9 513 1 Acacb Acetyl-CoA carboxylase 2 Mus musculus
A0A4P8DJE6 9.09e-55 204 28 8 519 3 dmxL1 Acetyl-CoA carboxylase dmxL1 Cryptosporiopsis sp. (strain 8999)
P78820 5.06e-52 196 27 8 507 1 cut6 Acetyl-CoA carboxylase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B8D1H3 2.45e-11 70 22 15 437 3 carB Carbamoyl phosphate synthase large chain Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B8D1H3 7.46e-08 59 21 7 273 3 carB Carbamoyl phosphate synthase large chain Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A2BJL3 7.08e-11 68 22 9 329 3 carB Carbamoyl phosphate synthase large chain Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
P55641 9.67e-11 67 29 9 222 4 NGR_a01790 Uncharacterized protein y4rH Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9ZB63 1.12e-10 68 25 6 225 3 carB Carbamoyl phosphate synthase arginine-specific large chain Geobacillus stearothermophilus
Q9ZB63 0.000199 48 24 6 224 3 carB Carbamoyl phosphate synthase arginine-specific large chain Geobacillus stearothermophilus
Q8U085 2.79e-10 67 25 13 324 3 carB Carbamoyl phosphate synthase large chain Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q9PEC1 1.24e-09 65 23 8 264 3 carB Carbamoyl phosphate synthase large chain Xylella fastidiosa (strain 9a5c)
B2GD06 2.48e-09 64 23 7 264 3 carB Carbamoyl phosphate synthase large chain Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q7VP67 4.47e-09 63 23 7 257 3 carB Carbamoyl phosphate synthase large chain Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7VP67 8.95e-05 49 22 11 276 3 carB Carbamoyl phosphate synthase large chain Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q67Q54 4.6e-09 63 23 6 245 3 carB Carbamoyl phosphate synthase large chain Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q67Q54 0.000204 48 23 9 257 3 carB Carbamoyl phosphate synthase large chain Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q8RBK0 5.73e-09 62 24 7 233 3 carB Carbamoyl phosphate synthase large chain Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q87EB8 7.18e-09 62 23 8 278 3 carB Carbamoyl phosphate synthase large chain Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q87EB8 0.000104 49 22 6 235 3 carB Carbamoyl phosphate synthase large chain Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q97FT3 8.21e-09 62 23 9 274 3 carB Carbamoyl phosphate synthase large chain Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q7SH52 8.64e-09 62 25 7 239 1 arg-3 Carbamoyl phosphate synthase arginine-specific large chain, mitochondrial Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P18185 1.07e-08 62 22 11 337 3 carB Carbamoyl phosphate synthase arginine-specific large chain Bacillus subtilis (strain 168)
P18185 1.17e-07 58 21 5 240 3 carB Carbamoyl phosphate synthase arginine-specific large chain Bacillus subtilis (strain 168)
B2UX86 1.31e-08 61 21 7 249 3 carB Carbamoyl phosphate synthase large chain Clostridium botulinum (strain Alaska E43 / Type E3)
A9KI94 1.5e-08 61 22 8 280 3 carB Carbamoyl phosphate synthase large chain Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
P58942 1.68e-08 61 21 7 295 3 carB Carbamoyl phosphate synthase large chain Xanthomonas axonopodis pv. citri (strain 306)
P58942 4.84e-05 50 23 5 188 3 carB Carbamoyl phosphate synthase large chain Xanthomonas axonopodis pv. citri (strain 306)
P58943 2.33e-08 60 21 7 295 3 carB Carbamoyl phosphate synthase large chain Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P58943 3.35e-05 50 23 5 188 3 carB Carbamoyl phosphate synthase large chain Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
A7GE89 3.03e-08 60 22 5 234 3 carB Carbamoyl phosphate synthase large chain Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B2THH3 3.17e-08 60 22 5 226 3 carB Carbamoyl phosphate synthase large chain Clostridium botulinum (strain Eklund 17B / Type B)
B1HQC1 3.24e-08 60 23 9 288 3 carB Carbamoyl phosphate synthase large chain Lysinibacillus sphaericus (strain C3-41)
Q9RLS9 3.9e-08 60 25 6 251 3 carB1 Carbamoyl phosphate synthase arginine-specific large chain Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B0K4D7 4.17e-08 60 22 6 251 3 carB Carbamoyl phosphate synthase large chain Thermoanaerobacter sp. (strain X514)
C4ZEK2 5.25e-08 59 23 7 273 3 carB Carbamoyl phosphate synthase large chain Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
B9EB69 6.66e-08 59 22 7 274 3 carB Carbamoyl phosphate synthase large chain Macrococcus caseolyticus (strain JCSC5402)
P03965 7.43e-08 59 24 5 194 1 CPA2 Carbamoyl phosphate synthase arginine-specific large chain Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B7IUP6 8.36e-08 59 21 14 398 3 carB Carbamoyl phosphate synthase large chain Bacillus cereus (strain G9842)
Q75D66 9.85e-08 58 21 9 321 3 CPA2 Carbamoyl phosphate synthase arginine-specific large chain Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
P46537 9.99e-08 58 22 7 273 3 carB Carbamoyl phosphate synthase large chain Bacillus caldolyticus
Q8CPJ4 1.01e-07 58 22 5 227 3 carB Carbamoyl phosphate synthase large chain Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q7S8A6 1.04e-07 58 20 8 351 1 pyr-3 Multifunctional protein pyr-3 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q7S8A6 3.22e-06 54 19 12 358 1 pyr-3 Multifunctional protein pyr-3 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q5HPY8 1.06e-07 58 22 5 227 3 carB Carbamoyl phosphate synthase large chain Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A8F453 1.25e-07 58 23 7 233 3 carB Carbamoyl phosphate synthase large chain Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
B1I4M8 1.57e-07 58 23 7 245 3 carB Carbamoyl phosphate synthase large chain Desulforudis audaxviator (strain MP104C)
B1I4M8 7.68e-06 52 24 9 265 3 carB Carbamoyl phosphate synthase large chain Desulforudis audaxviator (strain MP104C)
Q6HES8 1.62e-07 58 22 7 273 3 carB Carbamoyl phosphate synthase large chain Bacillus thuringiensis subsp. konkukian (strain 97-27)
B0KBW4 1.78e-07 58 22 6 229 3 carB Carbamoyl phosphate synthase large chain Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A7GRL1 1.78e-07 58 22 7 273 3 carB Carbamoyl phosphate synthase large chain Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
O50302 1.9e-07 58 22 7 273 3 pyrAB Carbamoyl phosphate synthase pyrimidine-specific large chain Geobacillus stearothermophilus
B2A170 1.9e-07 58 21 7 247 3 carB Carbamoyl phosphate synthase large chain Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
A9VTC6 2.28e-07 57 20 14 398 3 carB Carbamoyl phosphate synthase large chain Bacillus mycoides (strain KBAB4)
Q0SPY4 2.42e-07 57 21 5 226 3 carB Carbamoyl phosphate synthase large chain Clostridium perfringens (strain SM101 / Type A)
Q0SPY4 0.000667 46 22 6 234 3 carB Carbamoyl phosphate synthase large chain Clostridium perfringens (strain SM101 / Type A)
B2G564 2.65e-07 57 22 7 264 3 carB Carbamoyl phosphate synthase large chain Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VHN6 2.65e-07 57 22 7 264 3 carB Carbamoyl phosphate synthase large chain Limosilactobacillus reuteri (strain DSM 20016)
P05990 2.72e-07 57 22 4 194 1 r Multifunctional protein r Drosophila melanogaster
Q1D6Y8 2.88e-07 57 22 7 252 3 carB Carbamoyl phosphate synthase large chain Myxococcus xanthus (strain DK1622)
Q1D6Y8 1.31e-05 52 23 8 247 3 carB Carbamoyl phosphate synthase large chain Myxococcus xanthus (strain DK1622)
Q49WY4 2.99e-07 57 22 6 243 3 carB Carbamoyl phosphate synthase large chain Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q88DU6 3.27e-07 57 22 10 269 3 carB Carbamoyl phosphate synthase large chain Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88DU6 4.54e-06 53 23 7 236 3 carB Carbamoyl phosphate synthase large chain Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q03HB0 3.4e-07 57 25 7 247 3 carB Carbamoyl phosphate synthase large chain Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
C1FNY3 3.68e-07 57 21 5 234 3 carB Carbamoyl phosphate synthase large chain Clostridium botulinum (strain Kyoto / Type A2)
Q55756 3.96e-07 57 23 9 290 3 carB Carbamoyl phosphate synthase large chain Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q0TM79 4.26e-07 57 21 5 226 3 carB Carbamoyl phosphate synthase large chain Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0TM79 0.000684 46 22 6 231 3 carB Carbamoyl phosphate synthase large chain Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A6LPD9 4.45e-07 57 21 5 226 3 carB Carbamoyl phosphate synthase large chain Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q732I3 4.49e-07 57 21 7 273 3 carB Carbamoyl phosphate synthase large chain Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8XHB3 4.64e-07 56 21 5 226 3 carB Carbamoyl phosphate synthase large chain Clostridium perfringens (strain 13 / Type A)
Q8XHB3 0.000746 46 22 6 234 3 carB Carbamoyl phosphate synthase large chain Clostridium perfringens (strain 13 / Type A)
P27708 5.48e-07 56 24 4 181 1 CAD Multifunctional protein CAD Homo sapiens
Q9PIL7 5.98e-07 56 26 9 233 3 carB Carbamoyl phosphate synthase large chain Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q81WF2 6.11e-07 56 21 7 273 3 carB Carbamoyl phosphate synthase large chain Bacillus anthracis
C3L740 6.11e-07 56 21 7 273 3 carB Carbamoyl phosphate synthase large chain Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P656 6.11e-07 56 21 7 273 3 carB Carbamoyl phosphate synthase large chain Bacillus anthracis (strain A0248)
B9IVW3 6.17e-07 56 21 7 273 3 carB Carbamoyl phosphate synthase large chain Bacillus cereus (strain Q1)
B7HLM0 6.17e-07 56 21 7 273 3 carB Carbamoyl phosphate synthase large chain Bacillus cereus (strain AH187)
B7JJX3 6.44e-07 56 21 7 273 3 carB Carbamoyl phosphate synthase large chain Bacillus cereus (strain AH820)
Q636E0 6.49e-07 56 21 7 273 3 carB Carbamoyl phosphate synthase large chain Bacillus cereus (strain ZK / E33L)
C1EPQ0 6.89e-07 56 21 7 273 3 carB Carbamoyl phosphate synthase large chain Bacillus cereus (strain 03BB102)
A0RHQ8 6.89e-07 56 21 7 273 3 carB Carbamoyl phosphate synthase large chain Bacillus thuringiensis (strain Al Hakam)
Q9JXW8 7.84e-07 56 22 8 267 3 carB Carbamoyl phosphate synthase large chain Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JXW8 0.000491 47 23 5 188 3 carB Carbamoyl phosphate synthase large chain Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q5FJC0 9.13e-07 55 21 7 280 3 carB Carbamoyl phosphate synthase large chain Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A8YVZ3 9.69e-07 55 22 8 281 3 carB Carbamoyl phosphate synthase large chain Lactobacillus helveticus (strain DPC 4571)
Q9CKV0 9.96e-07 55 23 8 267 3 carB Carbamoyl phosphate synthase large chain Pasteurella multocida (strain Pm70)
A6WCC6 1e-06 55 24 8 235 3 carB Carbamoyl phosphate synthase large chain Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
A6WCC6 2.76e-05 51 23 8 246 3 carB Carbamoyl phosphate synthase large chain Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
B7H6M2 1.06e-06 55 21 7 273 3 carB Carbamoyl phosphate synthase large chain Bacillus cereus (strain B4264)
Q819S3 1.11e-06 55 21 7 273 3 carB Carbamoyl phosphate synthase large chain Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
O32771 1.21e-06 55 21 7 249 2 carB Carbamoyl phosphate synthase large chain Lactococcus lactis subsp. cremoris (strain MG1363)
Q7MNU0 1.25e-06 55 21 11 318 3 carB Carbamoyl phosphate synthase large chain Vibrio vulnificus (strain YJ016)
Q7MNU0 1.63e-05 52 20 6 264 3 carB Carbamoyl phosphate synthase large chain Vibrio vulnificus (strain YJ016)
Q8DEM2 1.25e-06 55 21 11 318 3 carB Carbamoyl phosphate synthase large chain Vibrio vulnificus (strain CMCP6)
Q8DEM2 1.63e-05 52 20 6 264 3 carB Carbamoyl phosphate synthase large chain Vibrio vulnificus (strain CMCP6)
O94313 1.25e-06 55 23 7 236 3 arg4 Carbamoyl phosphate synthase arginine-specific large chain, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8YQL2 1.25e-06 55 24 11 252 3 carB Carbamoyl phosphate synthase large chain Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9JW02 1.27e-06 55 22 8 267 3 carB Carbamoyl phosphate synthase large chain Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q38X24 1.41e-06 55 24 6 227 3 carB Carbamoyl phosphate synthase large chain Latilactobacillus sakei subsp. sakei (strain 23K)
Q02YG5 1.43e-06 55 21 7 249 3 carB Carbamoyl phosphate synthase large chain Lactococcus lactis subsp. cremoris (strain SK11)
Q1AVY9 1.63e-06 55 20 9 264 3 carB Carbamoyl phosphate synthase large chain Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1AVY9 0.000251 48 22 6 238 3 carB Carbamoyl phosphate synthase large chain Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q047M8 1.65e-06 55 22 8 281 3 carB Carbamoyl phosphate synthase large chain Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
P38100 1.65e-06 55 24 7 236 3 carB Carbamoyl phosphate synthase large chain Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P38100 0.000185 48 23 8 239 3 carB Carbamoyl phosphate synthase large chain Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q87SF3 1.67e-06 55 21 11 318 3 carB Carbamoyl phosphate synthase large chain Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87SF3 1.2e-05 52 20 6 264 3 carB Carbamoyl phosphate synthase large chain Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9K8V7 1.69e-06 55 23 8 263 3 carB Carbamoyl phosphate synthase arginine-specific large chain Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O28994 1.85e-06 54 21 11 320 3 carB Carbamoyl phosphate synthase large chain Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A5D508 1.95e-06 54 22 7 283 3 carB Carbamoyl phosphate synthase large chain Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A8Z3P0 1.95e-06 54 21 5 234 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain USA300 / TCH1516)
Q6GA10 1.95e-06 54 21 5 234 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain MSSA476)
Q6GHN2 1.95e-06 54 21 5 234 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain MRSA252)
A6QGA4 1.95e-06 54 21 5 234 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain Newman)
Q5HGM9 1.95e-06 54 21 5 234 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain COL)
Q2FZ72 1.95e-06 54 21 5 234 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHN5 1.95e-06 54 21 5 234 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain USA300)
P63740 1.97e-06 54 21 5 234 1 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain N315)
P63739 1.97e-06 54 21 5 234 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IS88 1.97e-06 54 21 5 234 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain JH9)
A6U122 1.97e-06 54 21 5 234 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain JH1)
A7X1F4 1.97e-06 54 21 5 234 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain Mu3 / ATCC 700698)
P58940 2.04e-06 54 21 5 234 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain MW2)
Q74J34 2.08e-06 54 20 6 260 3 carB Carbamoyl phosphate synthase large chain Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q87WP4 2.14e-06 54 23 7 236 3 carB Carbamoyl phosphate synthase large chain Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q87WP4 6.3e-05 50 22 10 279 3 carB Carbamoyl phosphate synthase large chain Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
C5C687 2.33e-06 54 23 8 250 3 carB Carbamoyl phosphate synthase large chain Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
C5C687 2.63e-05 51 22 10 266 3 carB Carbamoyl phosphate synthase large chain Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q2YXG5 2.85e-06 54 21 5 234 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q1WVA9 3.08e-06 54 20 5 240 3 carB Carbamoyl phosphate synthase large chain Ligilactobacillus salivarius (strain UCC118)
Q9KPH9 3.15e-06 54 23 14 329 3 carB Carbamoyl phosphate synthase large chain Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KPH9 4.21e-06 53 21 5 234 3 carB Carbamoyl phosphate synthase large chain Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8ZY48 3.39e-06 53 23 4 206 3 carB Carbamoyl phosphate synthase large chain Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
D3DJ41 3.54e-06 53 29 2 114 1 cfiA 2-oxoglutarate carboxylase large subunit Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)
P14846 3.61e-06 53 22 10 276 3 carB Carbamoyl phosphate synthase large chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P14846 1.67e-05 51 21 7 271 3 carB Carbamoyl phosphate synthase large chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q09794 3.62e-06 53 19 9 353 1 ura1 Multifunctional protein ura1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P25994 3.67e-06 53 22 13 313 1 pyrAB Carbamoyl phosphate synthase pyrimidine-specific large chain Bacillus subtilis (strain 168)
B9DPN2 3.95e-06 53 22 5 227 3 carB Carbamoyl phosphate synthase large chain Staphylococcus carnosus (strain TM300)
B9DPN2 0.000274 47 21 6 236 3 carB Carbamoyl phosphate synthase large chain Staphylococcus carnosus (strain TM300)
Q8Z9L7 4e-06 53 22 10 276 3 carB Carbamoyl phosphate synthase large chain Salmonella typhi
Q8Z9L7 1.95e-05 51 21 7 271 3 carB Carbamoyl phosphate synthase large chain Salmonella typhi
Q8FLB0 4.7e-06 53 22 10 276 3 carB Carbamoyl phosphate synthase large chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FLB0 9.09e-06 52 22 7 271 3 carB Carbamoyl phosphate synthase large chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P9WHL9 5.36e-06 52 26 6 196 1 purK N5-carboxyaminoimidazole ribonucleotide synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHL8 5.36e-06 52 26 6 196 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65899 5.36e-06 52 26 6 196 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B2RQC6 5.5e-06 53 23 4 181 1 Cad Multifunctional protein CAD Mus musculus
B3WEF5 5.56e-06 53 22 11 335 3 carB Carbamoyl phosphate synthase large chain Lacticaseibacillus casei (strain BL23)
P08955 5.64e-06 53 23 4 181 1 CAD Multifunctional protein CAD Mesocricetus auratus
Q038Z2 6.11e-06 53 22 11 335 3 carB Carbamoyl phosphate synthase large chain Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q8ZIL4 6.19e-06 53 22 10 278 3 carB Carbamoyl phosphate synthase large chain Yersinia pestis
Q8ZIL4 0.000475 47 21 8 269 3 carB Carbamoyl phosphate synthase large chain Yersinia pestis
Q970U7 6.37e-06 53 20 9 314 3 carB Carbamoyl phosphate synthase large chain Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
B0REV9 6.54e-06 53 24 6 194 3 carB Carbamoyl phosphate synthase large chain Clavibacter sepedonicus
B0REV9 2.88e-05 50 24 8 232 3 carB Carbamoyl phosphate synthase large chain Clavibacter sepedonicus
A8ACE0 6.86e-06 52 21 14 412 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
Q8TUT7 6.9e-06 52 19 7 254 3 carB2 Carbamoyl phosphate synthase large chain, C-terminal section Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q58773 7.36e-06 52 20 5 206 3 carB1 Carbamoyl phosphate synthase large chain, N-terminal section Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8F832 7.39e-06 52 23 10 258 3 carB Carbamoyl phosphate synthase large chain Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72NF1 7.39e-06 52 23 10 258 3 carB Carbamoyl phosphate synthase large chain Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8DZQ7 7.71e-06 52 21 7 249 3 carB Carbamoyl phosphate synthase large chain Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P00968 7.79e-06 52 22 10 276 1 carB Carbamoyl phosphate synthase large chain Escherichia coli (strain K12)
P00968 2.82e-05 51 21 7 271 1 carB Carbamoyl phosphate synthase large chain Escherichia coli (strain K12)
Q9RWK0 7.98e-06 52 23 19 428 3 carB Carbamoyl phosphate synthase large chain Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q9RWK0 0.000147 48 24 9 251 3 carB Carbamoyl phosphate synthase large chain Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A5CRX5 8.1e-06 52 24 6 194 3 carB Carbamoyl phosphate synthase large chain Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
A5CRX5 1.92e-05 51 24 8 232 3 carB Carbamoyl phosphate synthase large chain Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
A2RF60 8.11e-06 52 22 8 284 3 carB Carbamoyl phosphate synthase large chain Streptococcus pyogenes serotype M5 (strain Manfredo)
A2RF60 0.001 46 20 6 227 3 carB Carbamoyl phosphate synthase large chain Streptococcus pyogenes serotype M5 (strain Manfredo)
Q8E5F5 8.11e-06 52 21 7 249 3 carB Carbamoyl phosphate synthase large chain Streptococcus agalactiae serotype III (strain NEM316)
B5XKW2 8.18e-06 52 22 8 278 3 carB Carbamoyl phosphate synthase large chain Streptococcus pyogenes serotype M49 (strain NZ131)
B5XKW2 6.39e-05 50 21 6 240 3 carB Carbamoyl phosphate synthase large chain Streptococcus pyogenes serotype M49 (strain NZ131)
Q3K150 8.18e-06 52 21 7 249 3 carB Carbamoyl phosphate synthase large chain Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q42601 8.24e-06 52 25 6 188 1 CARB Carbamoyl phosphate synthase arginine-specific large chain, chloroplastic Arabidopsis thaliana
P63738 8.28e-06 52 22 10 276 3 carB Carbamoyl phosphate synthase large chain Shigella flexneri
P63738 4.67e-05 50 21 7 266 3 carB Carbamoyl phosphate synthase large chain Shigella flexneri
P63737 8.28e-06 52 22 10 276 3 carB Carbamoyl phosphate synthase large chain Escherichia coli O157:H7
P63737 4.67e-05 50 21 7 266 3 carB Carbamoyl phosphate synthase large chain Escherichia coli O157:H7
Q5XCR6 9.06e-06 52 22 8 278 3 carB Carbamoyl phosphate synthase large chain Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q5XCR6 0.000891 46 20 6 227 3 carB Carbamoyl phosphate synthase large chain Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q9A0C6 9.06e-06 52 22 8 278 3 carB Carbamoyl phosphate synthase large chain Streptococcus pyogenes serotype M1
Q9A0C6 0.000243 48 21 6 227 3 carB Carbamoyl phosphate synthase large chain Streptococcus pyogenes serotype M1
P58941 9.14e-06 52 22 8 278 3 carB Carbamoyl phosphate synthase large chain Streptococcus pyogenes serotype M18 (strain MGAS8232)
P58941 0.000883 46 20 6 227 3 carB Carbamoyl phosphate synthase large chain Streptococcus pyogenes serotype M18 (strain MGAS8232)
B9EXM2 9.35e-06 52 24 7 209 2 CARB Carbamoyl phosphate synthase arginine-specific large chain, chloroplastic Oryza sativa subsp. japonica
P07259 9.4e-06 52 20 4 187 1 URA2 Multifunctional protein URA2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
C1KWD4 9.57e-06 52 22 8 276 3 carB Carbamoyl phosphate synthase large chain Listeria monocytogenes serotype 4b (strain CLIP80459)
A0AJU0 9.82e-06 52 22 8 276 3 carB Carbamoyl phosphate synthase large chain Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B8DTW3 1.03e-05 52 22 7 244 3 carB Carbamoyl phosphate synthase large chain Bifidobacterium animalis subsp. lactis (strain AD011)
B8DTW3 0.00031 47 23 9 247 3 carB Carbamoyl phosphate synthase large chain Bifidobacterium animalis subsp. lactis (strain AD011)
Q8G815 1.05e-05 52 23 8 264 3 carB Carbamoyl phosphate synthase large chain Bifidobacterium longum (strain NCC 2705)
B3DQ32 1.05e-05 52 23 8 264 3 carB Carbamoyl phosphate synthase large chain Bifidobacterium longum (strain DJO10A)
Q71YI1 1.05e-05 52 22 8 276 3 carB Carbamoyl phosphate synthase large chain Listeria monocytogenes serotype 4b (strain F2365)
B8DDR7 1.1e-05 52 22 8 276 3 carB Carbamoyl phosphate synthase large chain Listeria monocytogenes serotype 4a (strain HCC23)
Q92AH3 1.11e-05 52 22 8 276 3 carB Carbamoyl phosphate synthase large chain Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9CFV2 1.11e-05 52 21 6 230 3 carB Carbamoyl phosphate synthase large chain Lactococcus lactis subsp. lactis (strain IL1403)
P0DA15 1.12e-05 52 22 8 278 3 carB Carbamoyl phosphate synthase large chain Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DA14 1.13e-05 52 22 8 278 3 carB Carbamoyl phosphate synthase large chain Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0DA14 0.000606 46 21 6 227 3 carB Carbamoyl phosphate synthase large chain Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
B7GPW2 1.16e-05 52 23 8 264 3 carB Carbamoyl phosphate synthase large chain Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8RG86 1.27e-05 52 22 9 292 3 carB Carbamoyl phosphate synthase large chain Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q0I600 1.28e-05 51 23 15 397 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Synechococcus sp. (strain CC9311)
Q91437 1.3e-05 52 22 4 183 2 CAD Multifunctional protein CAD Squalus acanthias
B2GI87 1.31e-05 52 22 8 248 3 carB Carbamoyl phosphate synthase large chain Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
P77886 1.33e-05 52 23 9 285 3 pyrAB Carbamoyl phosphate synthase pyrimidine-specific large chain Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P46056 1.35e-05 52 23 6 227 3 argA Carbamoyl phosphate synthase arginine-specific large chain Cutaneotrichosporon cutaneum
Q8Y665 1.48e-05 52 23 9 276 3 carB Carbamoyl phosphate synthase large chain Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8K9Z7 1.48e-05 52 23 5 190 3 carB Carbamoyl phosphate synthase large chain Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q8K9Z7 0.000174 48 22 8 238 3 carB Carbamoyl phosphate synthase large chain Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A1A0T4 1.67e-05 51 23 8 264 3 carB Carbamoyl phosphate synthase large chain Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
A1A0T4 5.69e-05 50 23 9 247 3 carB Carbamoyl phosphate synthase large chain Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
O67869 1.88e-05 51 21 6 235 3 carB1 Carbamoyl phosphate synthase large chain, N-terminal section Aquifex aeolicus (strain VF5)
B1KT07 1.96e-05 51 22 6 234 3 carB Carbamoyl phosphate synthase large chain Clostridium botulinum (strain Loch Maree / Type A3)
Q8REV7 2.03e-05 50 24 9 217 3 purD Phosphoribosylamine--glycine ligase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5SKN1 2.18e-05 51 25 5 203 3 carB Carbamoyl phosphate synthase large chain Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q03WW7 2.31e-05 51 23 7 272 3 carB Carbamoyl phosphate synthase large chain Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
C1A4I5 2.34e-05 51 21 12 315 3 carB Carbamoyl phosphate synthase large chain Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
C1A4I5 2.64e-05 51 22 13 350 3 carB Carbamoyl phosphate synthase large chain Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
O93937 2.51e-05 51 19 6 312 3 pyrABCN Multifunctional protein pyrABCN Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B9KXM5 2.52e-05 51 23 10 260 3 carB Carbamoyl phosphate synthase large chain Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
P59448 2.72e-05 51 21 12 295 3 carB Carbamoyl phosphate synthase large chain Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A2SQ53 2.73e-05 51 20 7 212 3 carB Carbamoyl phosphate synthase large chain Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
B1VYZ5 2.86e-05 50 26 9 237 3 ddl D-alanine--D-alanine ligase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
C4L5W3 3.01e-05 50 24 7 243 3 carB Carbamoyl phosphate synthase large chain Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B9KB91 3.54e-05 50 21 8 246 3 carB Carbamoyl phosphate synthase large chain Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
B9DRV7 3.69e-05 50 21 5 218 3 carB Carbamoyl phosphate synthase large chain Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q4L5Q5 3.72e-05 50 20 5 227 3 carB Carbamoyl phosphate synthase large chain Staphylococcus haemolyticus (strain JCSC1435)
A8AX83 3.89e-05 50 21 5 214 3 carB Carbamoyl phosphate synthase large chain Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B1W463 4.94e-05 50 22 9 276 3 carB Carbamoyl phosphate synthase large chain Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q98I87 5.08e-05 50 24 5 178 3 carB Carbamoyl phosphate synthase large chain Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q58628 5.58e-05 49 31 2 90 1 pycB Pyruvate carboxylase subunit B Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A5IJL8 6.49e-05 49 25 6 172 3 carB Carbamoyl phosphate synthase large chain Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9CCH9 6.64e-05 44 38 1 55 3 ML0802 Biotinylated protein TB7.3 homolog Mycobacterium leprae (strain TN)
Q9WZ27 6.95e-05 49 25 6 172 3 carB Carbamoyl phosphate synthase large chain Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
C1CL09 7.14e-05 49 20 7 249 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae (strain P1031)
Q9HK17 7.63e-05 49 22 8 258 3 carB Carbamoyl phosphate synthase large chain Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
P57244 7.68e-05 49 22 11 285 3 carB Carbamoyl phosphate synthase large chain Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P57244 0.000147 48 21 8 266 3 carB Carbamoyl phosphate synthase large chain Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8DUP3 9.07e-05 49 21 8 278 3 carB Carbamoyl phosphate synthase large chain Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
C3NH23 9.14e-05 49 21 10 316 3 carB Carbamoyl phosphate synthase large chain Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
C3NH23 0.000144 48 21 9 241 3 carB Carbamoyl phosphate synthase large chain Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
P9WPQ1 9.35e-05 44 35 1 67 1 Rv3221c Biotinylated protein TB7.3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPQ0 9.35e-05 44 35 1 67 3 MT3317 Biotinylated protein TB7.3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A511 9.35e-05 44 35 1 67 3 BQ2027_MB3247C Biotinylated protein TB7.3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
C0M756 9.63e-05 49 21 5 237 3 carB Carbamoyl phosphate synthase large chain Streptococcus equi subsp. equi (strain 4047)
O54030 0.000101 45 36 1 65 1 mmdC Methylmalonyl-CoA decarboxylase subunit gamma Propionigenium modestum
Q8TWX0 0.000102 48 24 6 199 3 carB1 Carbamoyl phosphate synthase large chain, N-terminal section Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
C4KHM7 0.000104 49 21 9 241 3 carB Carbamoyl phosphate synthase large chain Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
C4KHM7 0.000105 49 21 10 316 3 carB Carbamoyl phosphate synthase large chain Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
Q9A4D6 0.000104 49 24 6 201 3 carB Carbamoyl phosphate synthase large chain Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
C3MW21 0.000105 49 21 9 241 3 carB Carbamoyl phosphate synthase large chain Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C3MW21 0.000106 49 21 10 316 3 carB Carbamoyl phosphate synthase large chain Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C3N664 0.000105 49 21 9 241 3 carB Carbamoyl phosphate synthase large chain Sulfolobus islandicus (strain M.16.27)
C3N664 0.000106 49 21 10 316 3 carB Carbamoyl phosphate synthase large chain Sulfolobus islandicus (strain M.16.27)
C1CXR4 0.000137 48 22 6 217 3 carB Carbamoyl phosphate synthase large chain Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
C3NEM0 0.000143 48 21 9 241 3 carB Carbamoyl phosphate synthase large chain Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
C3NEM0 0.000144 48 21 10 316 3 carB Carbamoyl phosphate synthase large chain Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
C3MQE3 0.000143 48 21 9 241 3 carB Carbamoyl phosphate synthase large chain Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
C3MQE3 0.000144 48 21 10 316 3 carB Carbamoyl phosphate synthase large chain Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
Q9K9V9 0.000152 48 23 8 263 3 pyrAB Carbamoyl phosphate synthase pyrimidine-specific large chain Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q6A914 0.00016 48 22 6 234 3 carB Carbamoyl phosphate synthase large chain Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q8CWR0 0.000165 48 20 7 249 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
O50236 0.000167 48 22 8 250 3 carB Carbamoyl phosphate synthase large chain Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
C1CR31 0.000172 48 20 7 249 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae (strain Taiwan19F-14)
Q97QE4 0.000172 48 20 7 249 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04K48 0.000172 48 20 7 249 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B2IQ67 0.000175 48 20 7 249 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae (strain CGSP14)
B8ZJT9 0.000175 48 20 7 249 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1IC65 0.000177 48 20 5 234 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae (strain Hungary19A-6)
A0B8K9 0.000179 48 20 12 334 3 carB Carbamoyl phosphate synthase large chain Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
P07756 0.000181 48 23 5 191 1 Cps1 Carbamoyl-phosphate synthase [ammonia], mitochondrial Rattus norvegicus
B1L8T8 0.000181 48 25 6 172 3 carB Carbamoyl phosphate synthase large chain Thermotoga sp. (strain RQ2)
C1CEM9 0.000181 48 20 7 249 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae (strain JJA)
C1C7Q3 0.000181 48 20 7 249 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae (strain 70585)
Q59969 0.000196 48 22 9 243 3 carB Carbamoyl phosphate synthase large chain Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q59969 0.000221 48 22 4 185 3 carB Carbamoyl phosphate synthase large chain Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q91293 0.000208 48 23 5 191 2 None Carbamoyl-phosphate synthase [ammonia], mitochondrial Aquarana catesbeiana
P96495 0.000209 48 26 4 160 3 carB Carbamoyl phosphate synthase large chain Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q834E2 0.000245 48 20 11 334 3 carB Carbamoyl phosphate synthase large chain Enterococcus faecalis (strain ATCC 700802 / V583)
Q8C196 0.000246 48 23 5 191 1 Cps1 Carbamoyl-phosphate synthase [ammonia], mitochondrial Mus musculus
C0H419 0.000281 43 32 1 67 1 yngHB Biotin/lipoyl attachment protein Bacillus subtilis (strain 168)
Q1IWM0 0.000286 47 22 5 203 3 carB Carbamoyl phosphate synthase large chain Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q1IWM0 0.000512 47 23 8 254 3 carB Carbamoyl phosphate synthase large chain Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
C1F1S6 0.000287 47 22 6 244 3 carB Carbamoyl phosphate synthase large chain Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
B1YIR9 0.000304 47 23 7 243 3 carB Carbamoyl phosphate synthase large chain Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A3CNI5 0.000308 47 21 5 214 3 carB Carbamoyl phosphate synthase large chain Streptococcus sanguinis (strain SK36)
Q92PZ4 0.000328 47 23 5 178 3 carB Carbamoyl phosphate synthase large chain Rhizobium meliloti (strain 1021)
C0MEH1 0.00033 47 21 5 237 3 carB Carbamoyl phosphate synthase large chain Streptococcus equi subsp. zooepidemicus (strain H70)
B5E512 0.000333 47 20 7 249 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae serotype 19F (strain G54)
C5CCF1 0.000375 47 24 8 242 3 carB Carbamoyl phosphate synthase large chain Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
Q7UJ58 0.000407 47 19 7 241 3 carB Carbamoyl phosphate synthase large chain Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q7UJ58 0.000636 46 22 9 262 3 carB Carbamoyl phosphate synthase large chain Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8XGX8 0.000447 47 42 2 64 3 oadA1 Oxaloacetate decarboxylase alpha chain Salmonella typhi
Q8XZ83 0.000467 47 22 8 232 3 carB Carbamoyl phosphate synthase large chain Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q03030 0.000496 46 42 2 64 3 oadA1 Oxaloacetate decarboxylase alpha chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8RSS3 0.000521 47 20 12 382 3 carB Carbamoyl phosphate synthase large chain Halomonas eurihalina
O27179 0.000527 46 28 3 101 1 pycB Pyruvate carboxylase subunit B Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q827Q7 0.000694 46 22 9 276 3 carB Carbamoyl phosphate synthase large chain Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9CCR2 0.000709 46 21 6 235 3 carB Carbamoyl phosphate synthase large chain Mycobacterium leprae (strain TN)
Q03LT8 0.000757 46 20 7 249 3 carB Carbamoyl phosphate synthase large chain Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M5F6 0.000757 46 20 7 249 3 carB Carbamoyl phosphate synthase large chain Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M0W9 0.000757 46 20 7 249 3 carB Carbamoyl phosphate synthase large chain Streptococcus thermophilus (strain CNRZ 1066)
Q58776 0.000811 46 21 6 230 3 carB2 Carbamoyl phosphate synthase large chain, C-terminal section Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q1IPK2 0.000838 46 22 6 199 3 carB Carbamoyl phosphate synthase large chain Koribacter versatilis (strain Ellin345)
O27077 0.000899 46 22 14 383 3 carB Carbamoyl phosphate synthase large chain Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q4J8E8 0.001 46 20 11 345 3 carB Carbamoyl phosphate synthase large chain Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17705
Feature type CDS
Gene -
Product biotin carboxylase N-terminal domain-containing protein
Location 3887200 - 3888945 (strand: 1)
Length 1746 (nucleotides) / 581 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_250
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00289 Biotin carboxylase, N-terminal domain
PF00364 Biotin-requiring enzyme
PF02785 Biotin carboxylase C-terminal domain
PF02786 Carbamoyl-phosphate synthase L chain, ATP binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4770 Lipid transport and metabolism (I) I Acetyl/propionyl-CoA carboxylase, alpha subunit

Protein Sequence

MITTNQKQRVKHRVLIANRGEIAVRIIRACQDYGATSIAIYADDDIDALHVRLADEAYGLKGNSPKESYLAIDKIIEIAHKSKATMIHPGYGFLSERADFAKAVQQAGLLWIGPDPQTIEVLGDKVQARKIAQSVGAPLVNGTADPVSDAKEVLDFAKQYGLPIAIKAAFGGGGRGLKIAHHMAEIEELYHSAVREAVTAFGRGECYVEQFLDKPRHIEAQIIADKLGHVVVVGTRDCSLQRRNQKLIEEAPAPYLTDEQRQRIHQSAKDICAKAGYIGAGTVEFLLSANGTISFLEVNTRLQVEHPVTEETAGIDLVIEQLRIAEGLPLSINETPEPRGHSFEFRINAEDPAKGFLPTPGLISQFSQPAGPGVRVDSGVAENDQVSRQFDSMMAKLIVTGASREQAIARARRALAEFNIAGVASVLPFHRKMMEHPDFIDNFSVHTRWIESDFQAQKSHFPRSIPAENEPLVRTFIEIDGRRHQLALPAQLLSLSAVIPTAISEHKECQVRENAVTAPISGILHSWLLSDGDKVNQGDVIAIMEAMKMEVQVVATCHGVLQQKAKSGDYFSADSLLAEIN

Flanking regions ( +/- flanking 50bp)

TTTTAACCCAATTACTTTATTTCAAGAATATTGATAGGAGTATGCCACTCATGATAACAACTAACCAAAAGCAACGAGTGAAGCATCGAGTGTTGATTGCTAACAGAGGTGAAATCGCAGTTCGTATTATTCGTGCTTGTCAGGATTATGGTGCAACGTCCATTGCTATTTATGCAGATGATGATATAGATGCATTACATGTGCGTCTTGCAGATGAAGCCTATGGTTTAAAGGGTAACTCACCGAAAGAAAGTTATTTAGCGATAGATAAAATCATTGAAATTGCCCATAAAAGCAAAGCCACCATGATCCACCCTGGTTATGGCTTCCTTTCTGAGCGAGCTGATTTCGCTAAAGCGGTACAGCAAGCGGGACTCCTTTGGATTGGCCCAGATCCACAGACTATCGAAGTATTAGGGGATAAAGTTCAAGCGCGTAAAATTGCACAATCCGTAGGTGCACCATTGGTGAATGGTACTGCTGATCCGGTTAGTGATGCTAAAGAGGTTCTGGATTTTGCGAAACAGTATGGCTTGCCTATCGCCATTAAAGCGGCATTTGGTGGTGGTGGACGAGGCCTAAAAATTGCCCATCATATGGCAGAAATTGAAGAGCTTTACCATTCAGCGGTAAGAGAAGCAGTAACCGCATTTGGTCGTGGTGAATGCTATGTTGAGCAATTTCTTGATAAGCCTCGCCATATTGAGGCACAAATTATTGCTGATAAATTAGGCCATGTCGTGGTAGTTGGTACACGAGATTGTTCATTACAGCGCCGTAATCAAAAACTTATTGAAGAGGCCCCTGCCCCTTATTTAACTGATGAACAACGGCAACGTATTCATCAATCAGCAAAAGACATTTGTGCTAAAGCAGGTTATATCGGTGCGGGGACGGTAGAATTTTTATTGAGTGCGAACGGGACAATCTCTTTCCTTGAAGTGAATACACGTCTACAAGTAGAGCATCCGGTGACTGAAGAAACAGCCGGTATTGATTTAGTGATTGAACAATTGCGTATTGCTGAGGGATTACCGTTAAGTATTAATGAAACCCCTGAGCCTCGTGGCCATAGTTTTGAGTTTAGGATCAATGCAGAAGATCCGGCAAAAGGTTTTTTACCCACCCCCGGTTTAATTAGCCAATTTAGTCAACCGGCTGGGCCGGGCGTTCGTGTTGATAGTGGTGTGGCGGAAAATGACCAAGTATCACGTCAATTTGATTCAATGATGGCAAAACTTATTGTAACAGGGGCAAGTCGTGAACAAGCCATTGCGAGAGCGCGACGAGCTTTAGCTGAATTTAACATCGCAGGCGTAGCCAGTGTATTACCTTTTCATCGCAAAATGATGGAACATCCTGATTTTATTGATAACTTCAGTGTTCACACTCGTTGGATTGAAAGCGATTTTCAAGCACAAAAAAGTCATTTTCCTCGTAGTATACCAGCAGAAAATGAACCACTAGTGCGTACCTTTATTGAAATAGATGGTCGTCGTCATCAATTAGCGCTACCCGCACAATTACTTTCTCTCTCGGCCGTTATACCCACGGCTATTAGCGAGCACAAAGAGTGTCAGGTGCGGGAAAATGCGGTCACTGCACCGATTTCAGGGATATTACATAGTTGGTTATTATCCGATGGTGATAAAGTCAATCAAGGGGATGTTATTGCCATTATGGAGGCGATGAAAATGGAAGTACAGGTAGTTGCTACCTGTCATGGTGTATTGCAGCAAAAGGCGAAATCCGGTGACTATTTTTCAGCAGACAGTCTATTAGCTGAGATTAACTAGCTGAGTTATCAAACTATTATCGAGTAAGCCTCTTAGCAATAAGAGGCTTT