Homologs in group_315

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09305 FBDBKF_09305 58.5 Morganella morganii S1 sctS type III secretion system export apparatus subunit SctS
EHELCC_10105 EHELCC_10105 58.5 Morganella morganii S2 sctS type III secretion system export apparatus subunit SctS
NLDBIP_10450 NLDBIP_10450 58.5 Morganella morganii S4 sctS type III secretion system export apparatus subunit SctS
LHKJJB_10905 LHKJJB_10905 58.5 Morganella morganii S3 sctS type III secretion system export apparatus subunit SctS
HKOGLL_13965 HKOGLL_13965 58.5 Morganella morganii S5 sctS type III secretion system export apparatus subunit SctS
F4V73_RS08340 F4V73_RS08340 40.5 Morganella psychrotolerans sctS type III secretion system export apparatus subunit SctS
F4V73_RS10660 F4V73_RS10660 58.5 Morganella psychrotolerans sctS type III secretion system export apparatus subunit SctS

Distribution of the homologs in the orthogroup group_315

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_315

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A1L7 2.54e-27 97 54 0 81 1 spaQ Surface presentation of antigens protein SpaQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1M3 2.54e-27 97 54 0 81 3 spaQ Surface presentation of antigens protein SpaQ Salmonella typhisuis
P0A1L8 2.54e-27 97 54 0 81 3 spaQ Surface presentation of antigens protein SpaQ Salmonella typhi
P0A1M2 2.54e-27 97 54 0 81 3 spaQ Surface presentation of antigens protein SpaQ Salmonella senftenberg
P0A1M1 2.54e-27 97 54 0 81 3 spaQ Surface presentation of antigens protein SpaQ Salmonella gallinarum
P0A1M0 2.54e-27 97 54 0 81 3 spaQ Surface presentation of antigens protein SpaQ Salmonella enteritidis
P0A1L9 2.54e-27 97 54 0 81 3 spaQ Surface presentation of antigens protein SpaQ Salmonella dublin
P0A1M5 1.6e-25 93 57 0 76 3 spaQ Surface presentation of antigens protein SpaQ Shigella sonnei
P0A1M4 1.6e-25 93 57 0 76 1 spaQ Surface presentation of antigens protein SpaQ Shigella flexneri
P69983 6.56e-14 63 38 0 73 3 yscS Yop proteins translocation protein S Yersinia pseudotuberculosis serotype I (strain IP32953)
P69982 6.56e-14 63 38 0 73 3 yscS Yop proteins translocation protein S Yersinia pestis
P35535 6.94e-11 56 38 0 73 3 fliQ Flagellar biosynthetic protein FliQ Bacillus subtilis (strain 168)
P0CF98 4.94e-06 43 50 1 57 3 fliQ Flagellar biosynthetic protein FliQ Clostridium tetani (strain Massachusetts / E88)
P74891 2.31e-05 42 40 1 55 3 ssaS Secretion system apparatus protein SsaS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O67774 2.71e-05 41 38 1 55 3 fliQ Flagellar biosynthetic protein FliQ Aquifex aeolicus (strain VF5)
P0A1L5 3.08e-05 41 41 0 51 1 fliQ Flagellar biosynthetic protein FliQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1L6 3.08e-05 41 41 0 51 1 fliQ Flagellar biosynthetic protein FliQ Salmonella typhi
P74931 0.000156 40 30 0 73 3 fliQ Flagellar biosynthetic protein FliQ Treponema pallidum (strain Nichols)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13240
Feature type CDS
Gene sctS
Product type III secretion system export apparatus subunit SctS
Location 2939621 - 2939869 (strand: -1)
Length 249 (nucleotides) / 82 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_315
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01313 Bacterial export proteins, family 3

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4794 Intracellular trafficking, secretion, and vesicular transport (U) U Type III secretory pathway, EscS/YscS component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K22508 type III secretion system export apparatus protein - -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG002454 Type III secretion system protein BsaX VF0428 Effector delivery system

Protein Sequence

MVYAANKAIYLIILLSAAPIAIATFIGLLIGLLQTITQIQEQTLPFGVKLVGVFVCLLMMMGWMGDKLLIYAKEMLTIGLAG

Flanking regions ( +/- flanking 50bp)

AAGGGACTCATTAATCAATATCTTGATTTGATGGCGGTGAACTAGTGGATATGGTTTATGCGGCTAATAAAGCTATTTATTTGATTATATTGCTTTCAGCTGCGCCTATTGCTATCGCGACCTTTATTGGATTGCTTATTGGGCTATTGCAAACGATCACACAGATACAAGAGCAAACTTTACCTTTTGGTGTCAAGCTTGTGGGGGTTTTTGTTTGTTTACTTATGATGATGGGATGGATGGGAGATAAGTTACTAATTTATGCTAAAGAGATGTTGACGATTGGGTTAGCAGGGTAACTATCATGCTAGTACTGTTGCAATATATACAATCTTATTTAATCGATATT