Homologs in group_286

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09305 FBDBKF_09305 100.0 Morganella morganii S1 sctS type III secretion system export apparatus subunit SctS
EHELCC_10105 EHELCC_10105 100.0 Morganella morganii S2 sctS type III secretion system export apparatus subunit SctS
NLDBIP_10450 NLDBIP_10450 100.0 Morganella morganii S4 sctS type III secretion system export apparatus subunit SctS
LHKJJB_10905 LHKJJB_10905 100.0 Morganella morganii S3 sctS type III secretion system export apparatus subunit SctS
F4V73_RS08340 F4V73_RS08340 43.2 Morganella psychrotolerans sctS type III secretion system export apparatus subunit SctS
F4V73_RS10660 F4V73_RS10660 89.8 Morganella psychrotolerans sctS type III secretion system export apparatus subunit SctS
PMI_RS13240 PMI_RS13240 58.5 Proteus mirabilis HI4320 sctS type III secretion system export apparatus subunit SctS

Distribution of the homologs in the orthogroup group_286

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_286

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A1L7 1.48e-25 93 52 0 82 1 spaQ Surface presentation of antigens protein SpaQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1M3 1.48e-25 93 52 0 82 3 spaQ Surface presentation of antigens protein SpaQ Salmonella typhisuis
P0A1L8 1.48e-25 93 52 0 82 3 spaQ Surface presentation of antigens protein SpaQ Salmonella typhi
P0A1M2 1.48e-25 93 52 0 82 3 spaQ Surface presentation of antigens protein SpaQ Salmonella senftenberg
P0A1M1 1.48e-25 93 52 0 82 3 spaQ Surface presentation of antigens protein SpaQ Salmonella gallinarum
P0A1M0 1.48e-25 93 52 0 82 3 spaQ Surface presentation of antigens protein SpaQ Salmonella enteritidis
P0A1L9 1.48e-25 93 52 0 82 3 spaQ Surface presentation of antigens protein SpaQ Salmonella dublin
P0A1M5 2.24e-25 93 50 0 83 3 spaQ Surface presentation of antigens protein SpaQ Shigella sonnei
P0A1M4 2.24e-25 93 50 0 83 1 spaQ Surface presentation of antigens protein SpaQ Shigella flexneri
P69983 8.12e-17 71 50 0 74 3 yscS Yop proteins translocation protein S Yersinia pseudotuberculosis serotype I (strain IP32953)
P69982 8.12e-17 71 50 0 74 3 yscS Yop proteins translocation protein S Yersinia pestis
P35535 8.76e-12 58 40 0 77 3 fliQ Flagellar biosynthetic protein FliQ Bacillus subtilis (strain 168)
P0A1L5 1.21e-07 48 41 0 53 1 fliQ Flagellar biosynthetic protein FliQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1L6 1.21e-07 48 41 0 53 1 fliQ Flagellar biosynthetic protein FliQ Salmonella typhi
P55721 1.38e-05 42 36 1 68 3 NGR_a00600 Probable translocation protein y4yM Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P74891 1.45e-05 42 41 0 46 3 ssaS Secretion system apparatus protein SsaS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0CF98 1.7e-05 42 42 0 56 3 fliQ Flagellar biosynthetic protein FliQ Clostridium tetani (strain Massachusetts / E88)
Q8KA36 4.19e-05 41 40 0 52 3 fliQ Flagellar biosynthetic protein FliQ Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
O67774 5.92e-05 41 39 0 53 3 fliQ Flagellar biosynthetic protein FliQ Aquifex aeolicus (strain VF5)
P57185 0.000184 39 38 0 55 3 fliQ Flagellar biosynthetic protein FliQ Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P74931 0.000401 38 32 0 73 3 fliQ Flagellar biosynthetic protein FliQ Treponema pallidum (strain Nichols)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_13965
Feature type CDS
Gene sctS
Product type III secretion system export apparatus subunit SctS
Location 93954 - 94220 (strand: -1)
Length 267 (nucleotides) / 88 (amino acids)
In genomic island -

Contig

Accession ZDB_692
Length 124746 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_286
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01313 Bacterial export proteins, family 3

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4794 Intracellular trafficking, secretion, and vesicular transport (U) U Type III secretory pathway, EscS/YscS component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K22508 type III secretion system export apparatus protein - -

Protein Sequence

MDVIYAADKGIYLVIMLSLLPVSVATVVGLTVGLLQTVTQIQEQTLPFGLKLIAVFVCILMQLSWLGDSMLSYAREMFSLALSATAAG

Flanking regions ( +/- flanking 50bp)

GTTATCCACCAGTCTGGTGTCTCAGTATCTCGAACTTATGGACATATAACATGGATGTGATTTATGCAGCGGATAAAGGAATTTATCTGGTGATTATGTTATCGCTGCTGCCGGTGAGTGTGGCGACCGTCGTGGGTCTGACGGTCGGCCTGCTGCAGACTGTCACGCAGATCCAGGAGCAGACACTGCCCTTCGGGCTGAAATTGATTGCTGTGTTTGTCTGCATCCTGATGCAGCTCAGCTGGCTGGGGGATTCGATGCTCAGTTATGCCCGCGAAATGTTCTCACTGGCGCTCAGCGCAACAGCGGCAGGTTAGTTCCCGGTGTCGTTATTCTCCTGGCTTCATGACCTGTTTCAGAACGCGCT