Homologs in group_949

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04525 FBDBKF_04525 92.2 Morganella morganii S1 metK methionine adenosyltransferase
EHELCC_05815 EHELCC_05815 92.2 Morganella morganii S2 metK methionine adenosyltransferase
NLDBIP_06135 NLDBIP_06135 92.2 Morganella morganii S4 metK methionine adenosyltransferase
LHKJJB_03015 LHKJJB_03015 92.2 Morganella morganii S3 metK methionine adenosyltransferase
HKOGLL_06490 HKOGLL_06490 92.2 Morganella morganii S5 metK methionine adenosyltransferase
F4V73_RS08965 F4V73_RS08965 91.4 Morganella psychrotolerans metK methionine adenosyltransferase

Distribution of the homologs in the orthogroup group_949

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_949

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1A5 0.0 796 100 0 384 3 metK S-adenosylmethionine synthase Proteus mirabilis (strain HI4320)
A6TDV1 0.0 743 91 0 384 3 metK S-adenosylmethionine synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P66764 0.0 742 91 0 384 3 metK S-adenosylmethionine synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66765 0.0 742 91 0 384 3 metK S-adenosylmethionine synthase Salmonella typhi
B4TV58 0.0 742 91 0 384 3 metK S-adenosylmethionine synthase Salmonella schwarzengrund (strain CVM19633)
B5BFP7 0.0 742 91 0 384 3 metK S-adenosylmethionine synthase Salmonella paratyphi A (strain AKU_12601)
Q5PJJ2 0.0 742 91 0 384 3 metK S-adenosylmethionine synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T5J6 0.0 742 91 0 384 3 metK S-adenosylmethionine synthase Salmonella newport (strain SL254)
B5QY66 0.0 742 91 0 384 3 metK S-adenosylmethionine synthase Salmonella enteritidis PT4 (strain P125109)
Q57K26 0.0 742 91 0 384 3 metK S-adenosylmethionine synthase Salmonella choleraesuis (strain SC-B67)
B4THH4 0.0 741 91 0 384 3 metK S-adenosylmethionine synthase Salmonella heidelberg (strain SL476)
B5F5L4 0.0 741 91 0 384 3 metK S-adenosylmethionine synthase Salmonella agona (strain SL483)
B5XUA8 0.0 741 91 0 384 3 metK S-adenosylmethionine synthase Klebsiella pneumoniae (strain 342)
A8APG1 0.0 741 91 0 384 3 metK S-adenosylmethionine synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4WE78 0.0 740 91 0 384 3 metK S-adenosylmethionine synthase Enterobacter sp. (strain 638)
B5FUK0 0.0 739 91 0 384 3 metK S-adenosylmethionine synthase Salmonella dublin (strain CT_02021853)
Q7N119 0.0 739 91 0 384 3 metK S-adenosylmethionine synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A7MJQ6 0.0 738 91 0 384 3 metK S-adenosylmethionine synthase Cronobacter sakazakii (strain ATCC BAA-894)
A9MRD1 0.0 738 91 0 384 3 metK S-adenosylmethionine synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7LPQ9 0.0 738 91 0 384 3 metK S-adenosylmethionine synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B5RE50 0.0 737 91 0 384 3 metK S-adenosylmethionine synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q3YXS9 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Shigella sonnei (strain Ss046)
P0A820 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Shigella flexneri
Q0T0V0 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Shigella flexneri serotype 5b (strain 8401)
Q32C11 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Shigella dysenteriae serotype 1 (strain Sd197)
B1LDF1 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain SMS-3-5 / SECEC)
B6I780 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain SE11)
B7N7J5 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A817 0.0 736 90 0 384 1 metK S-adenosylmethionine synthase Escherichia coli (strain K12)
B1IT65 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A818 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TDR0 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A481 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O9:H4 (strain HS)
B1XFA4 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain K12 / DH10B)
C5A0L1 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LYX2 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O8 (strain IAI1)
B7NI05 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQD9 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A819 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O157:H7
B7LFK4 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain 55989 / EAEC)
B7UHY9 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZR64 0.0 736 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
A8GIX9 0.0 735 91 0 384 3 metK S-adenosylmethionine synthase Serratia proteamaculans (strain 568)
Q31WK4 0.0 734 90 0 384 3 metK S-adenosylmethionine synthase Shigella boydii serotype 4 (strain Sb227)
B2U0W2 0.0 734 90 0 384 3 metK S-adenosylmethionine synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1JNQ2 0.0 728 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q666P5 0.0 728 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TI83 0.0 728 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pestis (strain Pestoides F)
Q1CEX6 0.0 728 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R314 0.0 728 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZHG7 0.0 728 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pestis
B2K0S7 0.0 728 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CB69 0.0 728 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FEZ7 0.0 728 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2VF06 0.0 728 90 0 384 3 metK S-adenosylmethionine synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A1JPS4 0.0 722 89 0 384 3 metK S-adenosylmethionine synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2NRD1 0.0 707 87 1 385 3 metK S-adenosylmethionine synthase Sodalis glossinidius (strain morsitans)
C6DFI3 0.0 702 89 0 383 3 metK S-adenosylmethionine synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D081 0.0 699 88 0 383 3 metK S-adenosylmethionine synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C5BAV4 0.0 695 88 0 384 3 metK S-adenosylmethionine synthase Edwardsiella ictaluri (strain 93-146)
A3D0T8 0.0 688 85 0 383 3 metK S-adenosylmethionine synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A1RN71 0.0 687 84 0 383 3 metK S-adenosylmethionine synthase Shewanella sp. (strain W3-18-1)
A4Y3R7 0.0 686 84 0 383 3 metK S-adenosylmethionine synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q087Q9 0.0 686 84 0 383 3 metK S-adenosylmethionine synthase Shewanella frigidimarina (strain NCIMB 400)
A9L1M6 0.0 686 85 0 383 3 metK S-adenosylmethionine synthase Shewanella baltica (strain OS195)
A6WS79 0.0 686 85 0 383 3 metK S-adenosylmethionine synthase Shewanella baltica (strain OS185)
B8E5U7 0.0 686 85 0 383 3 metK S-adenosylmethionine synthase Shewanella baltica (strain OS223)
Q8EIB4 0.0 686 84 0 383 3 metK S-adenosylmethionine synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q12QA6 0.0 685 84 0 383 3 metK S-adenosylmethionine synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q0HRM1 0.0 684 84 0 383 3 metK S-adenosylmethionine synthase Shewanella sp. (strain MR-7)
Q0HM65 0.0 684 84 0 383 3 metK S-adenosylmethionine synthase Shewanella sp. (strain MR-4)
A0L0K9 0.0 684 84 0 383 3 metK S-adenosylmethionine synthase Shewanella sp. (strain ANA-3)
A3QAX5 0.0 684 84 0 383 3 metK S-adenosylmethionine synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1S9A6 0.0 683 84 0 383 3 metK S-adenosylmethionine synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B8CU43 0.0 680 84 1 384 3 metK S-adenosylmethionine synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
A1SZJ9 0.0 679 84 0 381 3 metK S-adenosylmethionine synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A8FRL1 0.0 679 84 0 383 3 metK S-adenosylmethionine synthase Shewanella sediminis (strain HAW-EB3)
Q3IDQ1 0.0 676 84 0 383 3 metK S-adenosylmethionine synthase Pseudoalteromonas translucida (strain TAC 125)
C3LRY9 0.0 675 86 0 381 3 metK S-adenosylmethionine synthase Vibrio cholerae serotype O1 (strain M66-2)
A5F9H4 0.0 675 86 0 381 3 metK S-adenosylmethionine synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KUP3 0.0 674 86 0 381 3 metK S-adenosylmethionine synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C4K3W7 0.0 672 82 0 384 3 metK S-adenosylmethionine synthase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A8H0M7 0.0 671 83 1 384 3 metK S-adenosylmethionine synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q7MHK6 0.0 671 85 0 384 3 metK S-adenosylmethionine synthase Vibrio vulnificus (strain YJ016)
Q8DCA3 0.0 671 85 0 384 3 metK S-adenosylmethionine synthase Vibrio vulnificus (strain CMCP6)
B1KF18 0.0 669 82 1 384 3 metK S-adenosylmethionine synthase Shewanella woodyi (strain ATCC 51908 / MS32)
Q87LK6 0.0 666 84 0 384 3 metK S-adenosylmethionine synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B0TUB8 0.0 665 82 1 384 3 metK S-adenosylmethionine synthase Shewanella halifaxensis (strain HAW-EB4)
Q15QK1 0.0 662 81 0 383 3 metK S-adenosylmethionine synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q6LMM8 0.0 657 83 0 384 3 metK S-adenosylmethionine synthase Photobacterium profundum (strain SS9)
A7MTQ7 0.0 654 82 0 384 3 metK S-adenosylmethionine synthase Vibrio campbellii (strain ATCC BAA-1116)
B4RWC7 0.0 654 81 0 378 3 metK S-adenosylmethionine synthase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B6EMV8 0.0 652 82 0 384 3 metK S-adenosylmethionine synthase Aliivibrio salmonicida (strain LFI1238)
Q1LU70 0.0 650 80 0 381 3 metK S-adenosylmethionine synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
B5F9T2 0.0 650 83 0 384 3 metK S-adenosylmethionine synthase Aliivibrio fischeri (strain MJ11)
Q5E7R2 0.0 650 83 0 384 3 metK S-adenosylmethionine synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A3N186 0.0 649 82 0 383 3 metK S-adenosylmethionine synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BQ17 0.0 649 82 0 383 3 metK S-adenosylmethionine synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H1W3 0.0 649 82 0 383 3 metK S-adenosylmethionine synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A5UIU0 0.0 647 80 0 384 3 metK S-adenosylmethionine synthase Haemophilus influenzae (strain PittGG)
Q4QLC5 0.0 646 80 0 384 3 metK S-adenosylmethionine synthase Haemophilus influenzae (strain 86-028NP)
P57897 0.0 646 81 0 384 3 metK S-adenosylmethionine synthase Pasteurella multocida (strain Pm70)
A5UCT6 0.0 645 80 0 384 3 metK S-adenosylmethionine synthase Haemophilus influenzae (strain PittEE)
A6VMK8 0.0 645 81 0 383 3 metK S-adenosylmethionine synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P43762 0.0 645 80 0 384 3 metK S-adenosylmethionine synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q65UT4 0.0 643 81 0 383 3 metK S-adenosylmethionine synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0UWT3 0.0 640 80 0 384 3 metK S-adenosylmethionine synthase Histophilus somni (strain 2336)
Q0I559 0.0 640 80 0 384 3 metK S-adenosylmethionine synthase Histophilus somni (strain 129Pt)
Q7VNG7 0.0 639 81 0 380 3 metK S-adenosylmethionine synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B7VKB3 0.0 638 81 0 383 3 metK S-adenosylmethionine synthase Vibrio atlanticus (strain LGP32)
B8D7U1 0.0 637 77 0 377 3 metK S-adenosylmethionine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57486 0.0 637 77 0 377 3 metK S-adenosylmethionine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9I9 0.0 637 77 0 377 3 metK S-adenosylmethionine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B8F4B2 0.0 635 81 0 380 3 metK S-adenosylmethionine synthase Glaesserella parasuis serovar 5 (strain SH0165)
Q5QVM7 0.0 634 78 0 378 3 metK S-adenosylmethionine synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q8K9E5 0.0 632 78 0 377 3 metK S-adenosylmethionine synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q60CG7 0.0 615 77 1 384 3 metK S-adenosylmethionine synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A6W3D6 0.0 611 77 2 382 3 metK S-adenosylmethionine synthase Marinomonas sp. (strain MWYL1)
Q8D2N8 0.0 605 71 0 384 3 metK S-adenosylmethionine synthase Wigglesworthia glossinidia brevipalpis
Q31EL0 0.0 605 75 1 385 3 metK S-adenosylmethionine synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q0A6D3 0.0 597 72 1 385 3 metK S-adenosylmethionine synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q486L6 0.0 596 71 1 395 3 metK S-adenosylmethionine synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A4XPF8 0.0 595 73 1 391 3 metK S-adenosylmethionine synthase Pseudomonas mendocina (strain ymp)
B1J2Z8 0.0 593 71 1 391 3 metK S-adenosylmethionine synthase Pseudomonas putida (strain W619)
Q1I3X6 0.0 592 71 1 391 3 metK S-adenosylmethionine synthase Pseudomonas entomophila (strain L48)
Q3K5E8 0.0 589 71 1 391 3 metK S-adenosylmethionine synthase Pseudomonas fluorescens (strain Pf0-1)
Q88D60 0.0 588 71 1 391 3 metK S-adenosylmethionine synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KLZ1 0.0 588 71 1 391 3 metK S-adenosylmethionine synthase Pseudomonas putida (strain GB-1)
A5WA00 0.0 588 71 1 391 3 metK S-adenosylmethionine synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
C3K3F5 0.0 587 71 1 391 3 metK S-adenosylmethionine synthase Pseudomonas fluorescens (strain SBW25)
Q4K4I7 0.0 587 71 1 391 3 metK S-adenosylmethionine synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C1DKE3 0.0 585 71 1 391 3 metK S-adenosylmethionine synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A1U547 0.0 585 70 1 392 3 metK S-adenosylmethionine synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B0RV66 0.0 583 69 2 403 3 metK S-adenosylmethionine synthase Xanthomonas campestris pv. campestris (strain B100)
Q4UR08 0.0 583 69 2 403 3 metK S-adenosylmethionine synthase Xanthomonas campestris pv. campestris (strain 8004)
Q1QCH2 0.0 582 72 1 384 3 metK S-adenosylmethionine synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q9I5Z0 0.0 582 70 1 391 3 metK S-adenosylmethionine synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02TL9 0.0 582 70 1 391 3 metK S-adenosylmethionine synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V4D3 0.0 582 70 1 391 3 metK S-adenosylmethionine synthase Pseudomonas aeruginosa (strain LESB58)
A6UZ09 0.0 582 70 1 391 3 metK S-adenosylmethionine synthase Pseudomonas aeruginosa (strain PA7)
A4VRE8 0.0 582 71 1 391 3 metK S-adenosylmethionine synthase Stutzerimonas stutzeri (strain A1501)
Q6FAQ6 0.0 582 72 1 383 3 metK S-adenosylmethionine synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
C5BTQ4 0.0 581 73 1 378 3 metK S-adenosylmethionine synthase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q8PCH3 0.0 581 68 2 403 3 metK S-adenosylmethionine synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q1R0L1 0.0 581 69 2 401 3 metK S-adenosylmethionine synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q4FTH7 0.0 580 72 1 384 3 metK S-adenosylmethionine synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B0U4E7 0.0 580 68 2 403 3 metK S-adenosylmethionine synthase Xylella fastidiosa (strain M12)
Q3J7R5 0.0 580 72 2 382 3 metK S-adenosylmethionine synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q5ZTY6 0.0 579 72 0 377 3 metK S-adenosylmethionine synthase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IDK5 0.0 578 72 0 377 3 metK S-adenosylmethionine synthase Legionella pneumophila (strain Corby)
Q5X3N0 0.0 578 72 0 377 3 metK S-adenosylmethionine synthase Legionella pneumophila (strain Paris)
Q9PGB0 0.0 578 68 2 403 3 metK S-adenosylmethionine synthase Xylella fastidiosa (strain 9a5c)
A9N9E2 0.0 578 72 1 383 3 metK S-adenosylmethionine synthase Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD87 0.0 578 72 1 383 3 metK S-adenosylmethionine synthase Coxiella burnetii (strain Dugway 5J108-111)
B6J3Q9 0.0 578 72 1 383 3 metK S-adenosylmethionine synthase Coxiella burnetii (strain CbuG_Q212)
B6J6H0 0.0 578 72 1 383 3 metK S-adenosylmethionine synthase Coxiella burnetii (strain CbuK_Q154)
Q5WV18 0.0 577 72 0 377 3 metK S-adenosylmethionine synthase Legionella pneumophila (strain Lens)
Q83A78 0.0 576 72 1 383 3 metK S-adenosylmethionine synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q87AY6 0.0 576 68 2 403 3 metK S-adenosylmethionine synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I898 0.0 576 68 2 403 3 metK S-adenosylmethionine synthase Xylella fastidiosa (strain M23)
B3PGF2 0.0 573 71 1 378 3 metK S-adenosylmethionine synthase Cellvibrio japonicus (strain Ueda107)
Q5GW76 0.0 572 71 1 374 3 metK S-adenosylmethionine synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SPP5 0.0 572 71 1 374 3 metK S-adenosylmethionine synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZF1 0.0 572 71 1 374 3 metK S-adenosylmethionine synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BXB7 0.0 572 71 1 374 3 metK S-adenosylmethionine synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PP75 0.0 572 71 1 374 3 metK S-adenosylmethionine synthase Xanthomonas axonopodis pv. citri (strain 306)
Q0VL83 0.0 572 72 0 376 3 metK S-adenosylmethionine synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q2SLT3 0.0 571 71 1 381 3 metK S-adenosylmethionine synthase Hahella chejuensis (strain KCTC 2396)
Q493F2 0.0 570 71 1 386 3 metK S-adenosylmethionine synthase Blochmanniella pennsylvanica (strain BPEN)
Q7WYG5 0.0 568 70 0 380 3 metK S-adenosylmethionine synthase Legionella jeonii
Q21NJ5 0.0 567 72 1 376 3 metK S-adenosylmethionine synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A5EY13 0.0 566 72 1 382 3 metK S-adenosylmethionine synthase Dichelobacter nodosus (strain VCS1703A)
B2FPC7 0.0 564 73 1 365 3 metK S-adenosylmethionine synthase Stenotrophomonas maltophilia (strain K279a)
A5WDU0 0.0 564 70 1 383 3 metK S-adenosylmethionine synthase Psychrobacter sp. (strain PRwf-1)
B4SK03 0.0 564 73 1 365 3 metK S-adenosylmethionine synthase Stenotrophomonas maltophilia (strain R551-3)
Q88AK7 0.0 562 69 1 379 3 metK S-adenosylmethionine synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZM01 0.0 561 69 1 379 3 metK S-adenosylmethionine synthase Pseudomonas syringae pv. syringae (strain B728a)
Q6AQ43 0.0 561 70 2 387 3 metK S-adenosylmethionine synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q48CH3 0.0 560 69 1 379 3 metK S-adenosylmethionine synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B0VC98 0.0 558 71 1 383 3 metK S-adenosylmethionine synthase Acinetobacter baumannii (strain AYE)
A3M4V2 0.0 558 71 1 383 3 metK S-adenosylmethionine synthase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VR30 0.0 558 71 1 383 3 metK S-adenosylmethionine synthase Acinetobacter baumannii (strain SDF)
B2HYY9 0.0 558 71 1 383 3 metK S-adenosylmethionine synthase Acinetobacter baumannii (strain ACICU)
Q7VRG5 0.0 553 68 2 385 3 metK S-adenosylmethionine synthase Blochmanniella floridana
A8GPW6 0.0 551 68 1 380 3 metK S-adenosylmethionine synthase Rickettsia akari (strain Hartford)
B5EN11 0.0 549 70 2 386 3 metK S-adenosylmethionine synthase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J551 0.0 549 70 2 386 3 metK S-adenosylmethionine synthase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q3SFY2 0.0 548 68 2 383 3 metK S-adenosylmethionine synthase Thiobacillus denitrificans (strain ATCC 25259)
Q3AFS4 0.0 540 65 3 396 3 metK S-adenosylmethionine synthase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A9IH21 0.0 534 69 2 381 3 metK S-adenosylmethionine synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q1LS34 0.0 533 69 3 383 3 metK S-adenosylmethionine synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q476V0 0.0 533 69 3 383 3 metK S-adenosylmethionine synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P56878 0.0 531 66 1 380 3 metK S-adenosylmethionine synthase Rickettsia prowazekii (strain Madrid E)
Q2Y5Z1 0.0 529 66 2 388 3 metK S-adenosylmethionine synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
C1DCT7 0.0 529 70 3 389 3 metK S-adenosylmethionine synthase Laribacter hongkongensis (strain HLHK9)
Q5KW02 0.0 528 65 3 392 3 metK S-adenosylmethionine synthase Geobacillus kaustophilus (strain HTA426)
Q7VUL5 0.0 528 68 2 381 3 metK S-adenosylmethionine synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W200 0.0 528 68 2 381 3 metK S-adenosylmethionine synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WQX8 0.0 528 68 2 381 3 metK S-adenosylmethionine synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q9RL99 0.0 528 65 1 380 3 metK S-adenosylmethionine synthase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A1K301 0.0 526 69 2 383 3 metK S-adenosylmethionine synthase Azoarcus sp. (strain BH72)
A4IRZ1 0.0 525 65 3 392 3 metK S-adenosylmethionine synthase Geobacillus thermodenitrificans (strain NG80-2)
Q7NZF9 0.0 525 69 3 389 3 metK S-adenosylmethionine synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
C5D6E9 0.0 524 64 3 392 3 metK S-adenosylmethionine synthase Geobacillus sp. (strain WCH70)
A6T2Z1 0.0 524 69 3 384 3 metK S-adenosylmethionine synthase Janthinobacterium sp. (strain Marseille)
Q0KF39 0.0 523 69 3 383 3 metK S-adenosylmethionine synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q21RM4 0.0 523 67 3 388 3 metK S-adenosylmethionine synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B1Y6S3 0.0 522 67 3 388 3 metK S-adenosylmethionine synthase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q8Y347 0.0 521 70 3 383 3 metK S-adenosylmethionine synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q5FAC0 0.0 521 68 3 389 1 metK S-adenosylmethionine synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A5CYJ7 0.0 521 62 3 396 3 metK S-adenosylmethionine synthase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q82WL2 0.0 521 66 2 387 3 metK S-adenosylmethionine synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A2SKW6 0.0 520 68 4 388 3 metK S-adenosylmethionine synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B4RQ36 0.0 520 68 3 389 3 metK S-adenosylmethionine synthase Neisseria gonorrhoeae (strain NCCP11945)
B8FSB9 0.0 519 62 3 396 3 metK S-adenosylmethionine synthase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B9DN19 0.0 518 63 4 390 3 metK S-adenosylmethionine synthase Staphylococcus carnosus (strain TM300)
A9BXF7 0.0 518 67 4 389 3 metK S-adenosylmethionine synthase Delftia acidovorans (strain DSM 14801 / SPH-1)
Q0AEV7 0.0 516 67 2 387 3 metK S-adenosylmethionine synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1KS98 0.0 514 68 3 389 3 metK S-adenosylmethionine synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A9M1V8 0.0 514 68 3 389 3 metK S-adenosylmethionine synthase Neisseria meningitidis serogroup C (strain 053442)
P50307 0.0 514 63 4 390 3 metK S-adenosylmethionine synthase Staphylococcus aureus
A9KL72 0.0 514 63 3 389 3 metK S-adenosylmethionine synthase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q5NIC7 0.0 514 66 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JT0 0.0 514 66 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. tularensis (strain FSC 198)
Q9JY09 0.0 513 68 3 389 3 metK S-adenosylmethionine synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JVV6 0.0 513 68 3 389 3 metK S-adenosylmethionine synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q8NVZ9 0.0 513 63 4 390 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain MW2)
A8Z4L2 0.0 513 63 4 390 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G8E3 0.0 513 63 4 390 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain MSSA476)
A6QHX0 0.0 513 63 4 390 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain Newman)
Q5HEY9 0.0 513 63 4 390 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain COL)
Q2YTK1 0.0 513 63 4 390 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G1W4 0.0 513 63 4 390 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFV6 0.0 513 63 4 390 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain USA300)
B2UD22 0.0 513 69 3 383 3 metK S-adenosylmethionine synthase Ralstonia pickettii (strain 12J)
Q9K7Q9 0.0 513 61 3 394 3 metK S-adenosylmethionine synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q0BKD0 0.0 513 66 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. holarctica (strain OSU18)
A0Q862 0.0 513 66 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. novicida (strain U112)
B2SFE1 0.0 513 66 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A1N2 0.0 513 66 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. holarctica (strain LVS)
A7NEB4 0.0 513 66 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q5WDZ8 0.0 513 62 3 390 3 metK S-adenosylmethionine synthase Shouchella clausii (strain KSM-K16)
Q0BAY8 0.0 512 68 2 385 3 metK S-adenosylmethionine synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YPQ4 0.0 512 68 2 385 3 metK S-adenosylmethionine synthase Burkholderia ambifaria (strain MC40-6)
Q6GFR6 0.0 511 62 4 390 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain MRSA252)
P66767 0.0 511 62 4 390 1 metK S-adenosylmethionine synthase Staphylococcus aureus (strain N315)
P66766 0.0 511 62 4 390 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ITV6 0.0 511 62 4 390 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain JH9)
A6U2Q1 0.0 511 62 4 390 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain JH1)
A7X3N2 0.0 511 62 4 390 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
B8I4C1 0.0 511 62 3 398 3 metK S-adenosylmethionine synthase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B0TX15 0.0 511 66 1 383 3 metK S-adenosylmethionine synthase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q47JN4 0.0 511 67 2 387 3 metK S-adenosylmethionine synthase Dechloromonas aromatica (strain RCB)
P61946 0.0 511 63 2 387 3 metK S-adenosylmethionine synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
C5CQF1 0.0 510 68 4 389 3 metK S-adenosylmethionine synthase Variovorax paradoxus (strain S110)
Q3A388 0.0 510 64 2 387 3 metK S-adenosylmethionine synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A1TKT9 1.16e-180 510 68 4 389 3 metK S-adenosylmethionine synthase Paracidovorax citrulli (strain AAC00-1)
A4IWA4 1.31e-180 509 66 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. tularensis (strain WY96-3418)
A4JIQ4 2.02e-180 509 68 2 385 3 metK S-adenosylmethionine synthase Burkholderia vietnamiensis (strain G4 / LMG 22486)
A1VK01 2.3e-180 509 66 5 391 3 metK S-adenosylmethionine synthase Polaromonas naphthalenivorans (strain CJ2)
A8FGH7 2.6e-180 509 62 3 392 3 metK S-adenosylmethionine synthase Bacillus pumilus (strain SAFR-032)
B9MDD1 3.04e-180 509 67 4 389 3 metK S-adenosylmethionine synthase Acidovorax ebreus (strain TPSY)
A5GA66 3.66e-180 508 64 2 387 3 metK S-adenosylmethionine synthase Geotalea uraniireducens (strain Rf4)
A3DHM4 3.74e-180 509 62 3 394 3 metK S-adenosylmethionine synthase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q1BSN9 4.73e-180 508 68 2 385 3 metK S-adenosylmethionine synthase Burkholderia orbicola (strain AU 1054)
B1K0F2 4.73e-180 508 68 2 385 3 metK S-adenosylmethionine synthase Burkholderia orbicola (strain MC0-3)
A0KBF2 4.73e-180 508 68 2 385 3 metK S-adenosylmethionine synthase Burkholderia cenocepacia (strain HI2424)
A1W3X4 5.61e-180 508 67 4 389 3 metK S-adenosylmethionine synthase Acidovorax sp. (strain JS42)
A4G977 5.69e-180 508 69 3 373 3 metK S-adenosylmethionine synthase Herminiimonas arsenicoxydans
Q39BZ1 1.86e-179 507 68 2 385 3 metK S-adenosylmethionine synthase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q5P2V5 1.88e-179 506 66 2 384 3 metK S-adenosylmethionine synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B4E800 1.94e-179 507 68 2 385 3 metK S-adenosylmethionine synthase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q1H4X2 2.21e-179 506 68 2 377 3 metK S-adenosylmethionine synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
P54419 4.87e-179 506 62 3 392 3 metK S-adenosylmethionine synthase Bacillus subtilis (strain 168)
B2JJY6 4.91e-179 506 68 2 383 3 metK S-adenosylmethionine synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B2T1P7 5.32e-179 506 67 2 383 3 metK S-adenosylmethionine synthase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q2T267 6.68e-179 505 68 2 385 3 metK S-adenosylmethionine synthase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A7Z7Y9 8.99e-179 505 62 3 392 3 metK S-adenosylmethionine synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q12FG9 9.95e-179 505 67 4 378 3 metK S-adenosylmethionine synthase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q65FV8 2.93e-178 504 62 3 392 3 metK S-adenosylmethionine synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q2RK28 3.19e-178 504 62 3 395 3 metK S-adenosylmethionine synthase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q146W0 3.81e-178 503 67 2 383 3 metK S-adenosylmethionine synthase Paraburkholderia xenovorans (strain LB400)
Q63YH5 4.43e-178 503 67 2 385 1 metK S-adenosylmethionine synthase Burkholderia pseudomallei (strain K96243)
A3N4I1 4.43e-178 503 67 2 385 3 metK S-adenosylmethionine synthase Burkholderia pseudomallei (strain 668)
Q3JX94 4.43e-178 503 67 2 385 3 metK S-adenosylmethionine synthase Burkholderia pseudomallei (strain 1710b)
A3NQ73 4.43e-178 503 67 2 385 3 metK S-adenosylmethionine synthase Burkholderia pseudomallei (strain 1106a)
A1V7L5 4.43e-178 503 67 2 385 3 metK S-adenosylmethionine synthase Burkholderia mallei (strain SAVP1)
Q62EZ1 4.43e-178 503 67 2 385 3 metK S-adenosylmethionine synthase Burkholderia mallei (strain ATCC 23344)
A2S860 4.43e-178 503 67 2 385 3 metK S-adenosylmethionine synthase Burkholderia mallei (strain NCTC 10229)
A3MRQ4 4.43e-178 503 67 2 385 3 metK S-adenosylmethionine synthase Burkholderia mallei (strain NCTC 10247)
Q837P9 6.34e-178 503 63 4 385 3 metK S-adenosylmethionine synthase Enterococcus faecalis (strain ATCC 700802 / V583)
B4ULF7 1.33e-177 502 66 3 381 3 metK S-adenosylmethionine synthase Anaeromyxobacter sp. (strain K)
A8MJT0 1.8e-177 502 61 3 395 3 metK S-adenosylmethionine synthase Alkaliphilus oremlandii (strain OhILAs)
B8J8T3 1.81e-177 501 66 3 381 3 metK S-adenosylmethionine synthase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A2RN40 2e-177 502 62 4 394 3 metK S-adenosylmethionine synthase Lactococcus lactis subsp. cremoris (strain MG1363)
B9MQ10 2.19e-177 501 63 4 390 3 metK S-adenosylmethionine synthase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q39W48 2.35e-177 501 62 2 387 3 metK S-adenosylmethionine synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
C6E2L2 2.53e-177 501 63 2 387 3 metK S-adenosylmethionine synthase Geobacter sp. (strain M21)
Q67T90 2.77e-177 501 62 2 391 3 metK S-adenosylmethionine synthase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A4XHT8 4.61e-177 501 62 4 393 3 metK S-adenosylmethionine synthase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B0KC73 1.67e-176 499 60 2 393 3 metK S-adenosylmethionine synthase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q38YF8 2.06e-176 499 61 4 387 3 metK S-adenosylmethionine synthase Latilactobacillus sakei subsp. sakei (strain 23K)
A1WSC8 2.67e-176 499 65 4 389 3 metK S-adenosylmethionine synthase Verminephrobacter eiseniae (strain EF01-2)
A4T0F0 3.09e-176 498 67 2 384 3 metK S-adenosylmethionine synthase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B1I6C4 3.19e-176 499 62 3 391 3 metK S-adenosylmethionine synthase Desulforudis audaxviator (strain MP104C)
Q02WN8 3.22e-176 499 63 4 390 3 metK S-adenosylmethionine synthase Lactococcus lactis subsp. cremoris (strain SK11)
A7GU40 4.05e-176 498 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B1XSH9 1.09e-175 497 67 2 384 3 metK S-adenosylmethionine synthase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q2IM98 1.13e-175 497 65 3 381 3 metK S-adenosylmethionine synthase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q49YL6 1.18e-175 497 61 3 389 3 metK S-adenosylmethionine synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B9K7H2 1.66e-175 497 60 3 393 3 metK S-adenosylmethionine synthase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
B1LB17 2.41e-175 496 60 3 393 3 metK S-adenosylmethionine synthase Thermotoga sp. (strain RQ2)
A5ILS4 2.41e-175 496 60 3 393 3 metK S-adenosylmethionine synthase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9X1Y8 2.41e-175 496 60 3 393 3 metK S-adenosylmethionine synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q632S5 2.93e-175 496 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain ZK / E33L)
B9J265 2.93e-175 496 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain Q1)
B7JT32 2.93e-175 496 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain AH820)
Q81KI0 2.93e-175 496 61 3 394 3 metK S-adenosylmethionine synthase Bacillus anthracis
C3LAZ9 2.93e-175 496 61 3 394 3 metK S-adenosylmethionine synthase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PCC4 2.93e-175 496 61 3 394 3 metK S-adenosylmethionine synthase Bacillus anthracis (strain A0248)
B7IL28 3.16e-175 496 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain G9842)
Q9CEE0 3.23e-175 496 62 4 394 3 metK S-adenosylmethionine synthase Lactococcus lactis subsp. lactis (strain IL1403)
Q6HCB4 3.77e-175 496 61 3 394 3 metK S-adenosylmethionine synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
B7HSV6 3.77e-175 496 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain AH187)
C1EW36 8.02e-175 495 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain 03BB102)
A0RJZ7 8.02e-175 495 61 3 394 3 metK S-adenosylmethionine synthase Bacillus thuringiensis (strain Al Hakam)
Q816Q8 1.46e-174 494 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7H9C7 1.46e-174 494 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain B4264)
Q8EP05 1.76e-174 494 61 3 388 3 metK S-adenosylmethionine synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A8YWU7 2.12e-174 494 61 4 391 3 metK S-adenosylmethionine synthase Lactobacillus helveticus (strain DPC 4571)
Q72YV6 2.17e-174 494 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
A7NFR6 2.35e-174 494 60 3 394 3 metK S-adenosylmethionine synthase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q92AZ5 2.98e-174 494 62 6 396 3 metK S-adenosylmethionine synthase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A9VLC6 3.01e-174 494 61 3 394 3 metK S-adenosylmethionine synthase Bacillus mycoides (strain KBAB4)
Q7VFY5 3.11e-174 493 62 2 384 3 metK S-adenosylmethionine synthase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A0LF65 3.73e-174 493 61 2 387 3 metK S-adenosylmethionine synthase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A8ZYC8 3.97e-174 493 63 2 385 3 metK S-adenosylmethionine synthase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q7M7Z2 4.04e-174 493 60 2 382 3 metK S-adenosylmethionine synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A4J945 4.39e-174 493 59 3 399 3 metK S-adenosylmethionine synthase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q03QA4 4.77e-174 493 63 4 390 3 metK S-adenosylmethionine synthase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q18CL7 5.12e-174 493 59 3 396 3 metK S-adenosylmethionine synthase Clostridioides difficile (strain 630)
B8DFQ7 5.74e-174 493 62 6 396 3 metK S-adenosylmethionine synthase Listeria monocytogenes serotype 4a (strain HCC23)
Q71Z03 5.74e-174 493 62 6 396 3 metK S-adenosylmethionine synthase Listeria monocytogenes serotype 4b (strain F2365)
C1KVW3 5.74e-174 493 62 6 396 3 metK S-adenosylmethionine synthase Listeria monocytogenes serotype 4b (strain CLIP80459)
B9LBJ9 1.12e-173 493 63 4 391 3 metK S-adenosylmethionine synthase Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WGQ3 1.12e-173 493 63 4 391 3 metK S-adenosylmethionine synthase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A0AJB9 1.42e-173 492 62 6 396 3 metK S-adenosylmethionine synthase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q98A80 1.75e-173 491 64 3 381 3 metK S-adenosylmethionine synthase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q4L7C7 1.8e-173 492 60 4 390 3 metK S-adenosylmethionine synthase Staphylococcus haemolyticus (strain JCSC1435)
Q8Y6M0 4.63e-173 491 62 6 396 3 metK S-adenosylmethionine synthase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
A5UQL0 7.36e-173 491 60 3 394 3 metK S-adenosylmethionine synthase Roseiflexus sp. (strain RS-1)
Q0AXL1 1.58e-172 489 59 2 396 3 metK S-adenosylmethionine synthase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q5FIN8 1.98e-172 489 60 4 391 3 metK S-adenosylmethionine synthase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A7H6N1 3.09e-172 488 63 3 385 3 metK S-adenosylmethionine synthase Anaeromyxobacter sp. (strain Fw109-5)
A0LCX5 8.93e-172 487 62 3 386 3 metK S-adenosylmethionine synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q9L0Y3 1.86e-171 487 60 5 402 3 metK S-adenosylmethionine synthase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A3CNY4 2.57e-171 486 60 4 389 3 metK S-adenosylmethionine synthase Streptococcus sanguinis (strain SK36)
A8AWW6 4.29e-171 486 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q74KS4 1.19e-170 485 60 3 389 3 metK S-adenosylmethionine synthase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
B6JPU7 1.19e-170 484 61 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain P12)
A4VWU8 1.76e-170 484 61 4 389 3 metK S-adenosylmethionine synthase Streptococcus suis (strain 05ZYH33)
A4W351 1.76e-170 484 61 4 389 3 metK S-adenosylmethionine synthase Streptococcus suis (strain 98HAH33)
B5Z9W8 4.19e-170 483 61 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain G27)
Q8RCE4 4.3e-170 483 58 2 393 3 metK S-adenosylmethionine synthase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
C0ZZD4 4.69e-170 483 61 4 399 3 metK S-adenosylmethionine synthase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
A7HJA9 5.6e-170 483 59 3 394 3 metK S-adenosylmethionine synthase Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Q9ZMN5 6.15e-170 482 61 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain J99 / ATCC 700824)
B7IEV2 1.39e-169 482 59 4 391 3 metK S-adenosylmethionine synthase Thermosipho africanus (strain TCF52B)
Q8DQH0 1.69e-169 481 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2INE5 1.69e-169 481 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain CGSP14)
B1IAT8 1.69e-169 481 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain Hungary19A-6)
B5E364 1.69e-169 481 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae serotype 19F (strain G54)
Q04LE0 1.69e-169 481 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B8ZNB7 2.27e-169 481 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B2US27 2.36e-169 481 61 2 375 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain Shi470)
P56460 2.39e-169 481 61 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain ATCC 700392 / 26695)
Q8CNT5 3.11e-169 481 58 4 394 3 metK S-adenosylmethionine synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNB8 3.11e-169 481 58 4 394 3 metK S-adenosylmethionine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
C1C6A5 3.4e-169 481 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain 70585)
Q88XB8 4.51e-169 481 62 4 387 1 metK S-adenosylmethionine synthase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
C1CJL0 7.08e-169 480 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain P1031)
Q1CUW4 7.44e-169 479 61 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain HPAG1)
Q8E5Y0 1.43e-168 479 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus agalactiae serotype III (strain NEM316)
C1CQM2 1.44e-168 479 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain Taiwan19F-14)
Q97RN9 1.44e-168 479 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B2G8G3 3.97e-168 478 61 4 391 3 metK S-adenosylmethionine synthase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VL29 3.97e-168 478 61 4 391 3 metK S-adenosylmethionine synthase Limosilactobacillus reuteri (strain DSM 20016)
B1W470 5.79e-168 478 60 5 402 3 metK S-adenosylmethionine synthase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B9DSM6 6.08e-168 478 59 4 390 3 metK S-adenosylmethionine synthase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
A9BHX2 6.37e-168 478 58 5 401 3 metK S-adenosylmethionine synthase Petrotoga mobilis (strain DSM 10674 / SJ95)
Q827Q0 8.58e-168 478 59 5 402 3 metK S-adenosylmethionine synthase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8E0A3 1.18e-167 477 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3K1M7 1.18e-167 477 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8DT23 1.27e-167 477 60 4 389 3 metK S-adenosylmethionine synthase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q17YQ7 1.73e-167 476 60 2 378 3 metK S-adenosylmethionine synthase Helicobacter acinonychis (strain Sheeba)
C1CDB0 2.07e-167 476 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain JJA)
A6Q1Z8 3e-167 476 61 2 373 3 metK S-adenosylmethionine synthase Nitratiruptor sp. (strain SB155-2)
A9EXT3 3.25e-167 477 61 1 381 3 metK S-adenosylmethionine synthase Sorangium cellulosum (strain So ce56)
Q0SR05 3.95e-167 475 61 2 387 3 metK S-adenosylmethionine synthase Clostridium perfringens (strain SM101 / Type A)
Q0TND4 3.95e-167 475 61 2 387 3 metK S-adenosylmethionine synthase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q5SHT8 2.01e-166 474 58 3 391 3 metK S-adenosylmethionine synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72I53 2.01e-166 474 58 3 391 1 metK S-adenosylmethionine synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q0S0L4 2.21e-166 474 60 3 399 3 metK S-adenosylmethionine synthase Rhodococcus jostii (strain RHA1)
C1B4J7 2.34e-166 474 60 3 399 3 metK S-adenosylmethionine synthase Rhodococcus opacus (strain B4)
Q5YTN0 3.17e-166 474 59 4 399 3 metK S-adenosylmethionine synthase Nocardia farcinica (strain IFM 10152)
Q47R14 3.26e-166 473 60 4 396 3 metK S-adenosylmethionine synthase Thermobifida fusca (strain YX)
A0Q2Y4 1.64e-165 471 60 3 387 3 metK S-adenosylmethionine synthase Clostridium novyi (strain NT)
A6LNU4 1.83e-165 471 58 4 390 3 metK S-adenosylmethionine synthase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q311V1 1.87e-165 471 61 3 380 3 metK S-adenosylmethionine synthase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
C4XPZ6 2.7e-165 471 62 1 379 3 metK S-adenosylmethionine synthase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q1CY83 3.09e-165 471 62 4 383 3 metK S-adenosylmethionine synthase Myxococcus xanthus (strain DK1622)
Q48SU7 3.54e-165 471 59 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1WUT4 4.34e-165 470 63 4 388 3 metK S-adenosylmethionine synthase Ligilactobacillus salivarius (strain UCC118)
Q898W7 7.66e-165 469 59 2 385 3 metK S-adenosylmethionine synthase Clostridium tetani (strain Massachusetts / E88)
Q6MPK2 1.28e-164 469 62 1 382 3 metK S-adenosylmethionine synthase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q5XBJ6 1.89e-164 469 59 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q03AU4 1.95e-164 469 58 5 386 3 metK S-adenosylmethionine synthase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WCC9 1.95e-164 469 58 5 386 3 metK S-adenosylmethionine synthase Lacticaseibacillus casei (strain BL23)
Q9X4Q2 2.41e-164 469 59 5 394 3 metK S-adenosylmethionine synthase Streptomyces spectabilis
B5XM14 2.73e-164 468 59 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M49 (strain NZ131)
A2RE06 2.73e-164 468 59 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JL80 2.73e-164 468 59 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JB36 2.73e-164 468 59 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q8P0G6 2.73e-164 468 59 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DF55 2.83e-164 468 59 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DF54 2.83e-164 468 59 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q1J626 3.63e-164 468 59 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M4 (strain MGAS10750)
C0M9M7 5.79e-164 468 59 3 388 3 metK S-adenosylmethionine synthase Streptococcus equi subsp. equi (strain 4047)
C0MCM1 7.2e-164 468 59 3 388 3 metK S-adenosylmethionine synthase Streptococcus equi subsp. zooepidemicus (strain H70)
B4U228 8.12e-164 468 59 3 388 3 metK S-adenosylmethionine synthase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
B1KST9 1.02e-163 467 61 3 386 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Loch Maree / Type A3)
Q5M434 1.02e-163 467 58 4 389 3 metK S-adenosylmethionine synthase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q99Z77 1.26e-163 467 59 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M1
C1FQQ5 1.46e-163 466 61 3 386 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Kyoto / Type A2)
Q1JGA1 1.64e-163 466 59 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q84FD3 1.65e-163 466 62 4 383 3 metK S-adenosylmethionine synthase Myxococcus xanthus
Q30PN0 2.02e-163 466 58 2 381 3 metK S-adenosylmethionine synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A1VBJ1 2.22e-163 466 61 3 382 3 metK S-adenosylmethionine synthase Nitratidesulfovibrio vulgaris (strain DP4)
Q729A3 2.22e-163 466 61 3 382 1 metK S-adenosylmethionine synthase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A5HY62 2.45e-163 466 61 3 386 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FQI8 2.45e-163 466 61 3 386 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain ATCC 19397 / Type A)
Q97F85 2.7e-163 466 60 3 386 3 metK S-adenosylmethionine synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B2GDG2 3.39e-163 466 60 4 391 3 metK S-adenosylmethionine synthase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
A7G9S1 4.23e-163 465 61 3 386 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q5LZI0 4.48e-163 465 58 4 389 3 metK S-adenosylmethionine synthase Streptococcus thermophilus (strain CNRZ 1066)
A1SJF9 6.99e-163 465 61 5 384 3 metK S-adenosylmethionine synthase Nocardioides sp. (strain ATCC BAA-499 / JS614)
B1IE45 7.3e-163 464 61 3 386 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Okra / Type B1)
A8LE19 7.58e-163 465 60 5 395 3 metK S-adenosylmethionine synthase Parafrankia sp. (strain EAN1pec)
A5CRX0 1.82e-162 464 58 4 398 3 metK S-adenosylmethionine synthase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q03GG8 2.02e-162 464 62 4 388 3 metK S-adenosylmethionine synthase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B7JX26 2.64e-162 464 57 7 413 3 metK S-adenosylmethionine synthase Rippkaea orientalis (strain PCC 8801 / RF-1)
B7KFF5 4.79e-162 464 57 6 405 3 metK S-adenosylmethionine synthase Gloeothece citriformis (strain PCC 7424)
Q3ZZN7 4.99e-162 463 56 3 388 3 metK S-adenosylmethionine synthase Dehalococcoides mccartyi (strain CBDB1)
B0REV4 6.74e-162 462 58 4 398 3 metK S-adenosylmethionine synthase Clavibacter sepedonicus
B1VDN7 6.93e-162 462 57 4 399 3 metK S-adenosylmethionine synthase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q73JR4 1.03e-161 462 60 2 382 3 metK S-adenosylmethionine synthase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q938W7 1.57e-161 462 58 5 407 3 metK S-adenosylmethionine synthase Streptomyces fradiae
A5FRV2 4.07e-161 461 56 3 388 3 metK S-adenosylmethionine synthase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
A4X626 4.47e-161 460 58 4 398 3 metK S-adenosylmethionine synthase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
C6C1U5 5.63e-161 460 59 1 382 3 metK S-adenosylmethionine synthase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q3Z943 5.7e-161 460 55 3 388 3 metK S-adenosylmethionine synthase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
B2TK10 6.44e-161 459 59 3 387 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Eklund 17B / Type B)
A6QBY6 7.34e-161 459 58 3 383 3 metK S-adenosylmethionine synthase Sulfurovum sp. (strain NBC37-1)
Q7WYN1 1.26e-160 459 59 4 394 3 metK S-adenosylmethionine synthase Mycolicibacterium smegmatis
A0QWT3 1.26e-160 459 59 4 394 1 metK S-adenosylmethionine synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A8LY25 2.28e-160 459 58 4 398 3 metK S-adenosylmethionine synthase Salinispora arenicola (strain CNS-205)
B2IUI4 2.36e-160 459 56 6 414 3 metK S-adenosylmethionine synthase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
B1XPB0 3.73e-160 459 55 6 405 3 metK S-adenosylmethionine synthase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
B0S2I6 9.18e-160 457 55 2 390 3 metK S-adenosylmethionine synthase Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q10VU5 1.36e-159 457 54 5 408 3 metK S-adenosylmethionine synthase Trichodesmium erythraeum (strain IMS101)
B2UZL0 2.73e-159 456 58 3 387 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Alaska E43 / Type E3)
Q2J843 4.11e-159 455 58 4 395 3 metK2 S-adenosylmethionine synthase 2 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
B1WZM0 1.29e-158 455 56 6 406 3 metK S-adenosylmethionine synthase Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q4JVH7 1.46e-158 454 58 6 403 3 metK S-adenosylmethionine synthase Corynebacterium jeikeium (strain K411)
Q6AF79 1.77e-158 454 58 3 392 3 metK S-adenosylmethionine synthase Leifsonia xyli subsp. xyli (strain CTCB07)
Q1J1P4 4.53e-158 453 55 3 398 3 metK S-adenosylmethionine synthase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q8DK88 5.24e-158 453 55 6 407 3 metK S-adenosylmethionine synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B8DSC3 6.47e-158 452 59 1 382 3 metK S-adenosylmethionine synthase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
C1CY25 8.01e-158 452 56 4 398 3 metK S-adenosylmethionine synthase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q1B9F3 8.08e-158 452 58 5 397 3 metK S-adenosylmethionine synthase Mycobacterium sp. (strain MCS)
A1UFL0 8.08e-158 452 58 5 397 3 metK S-adenosylmethionine synthase Mycobacterium sp. (strain KMS)
A3PZ71 8.08e-158 452 58 5 397 3 metK S-adenosylmethionine synthase Mycobacterium sp. (strain JLS)
A8F5B8 1.03e-157 452 55 4 391 3 metK S-adenosylmethionine synthase Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
B8HWM0 1.7e-157 452 55 5 406 3 metK S-adenosylmethionine synthase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
C3PG24 2.09e-157 451 57 5 397 3 metK S-adenosylmethionine synthase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
A0QI26 3.61e-157 451 58 5 397 1 metK S-adenosylmethionine synthase Mycobacterium avium (strain 104)
Q9RWM6 4.69e-157 451 55 3 398 3 metK S-adenosylmethionine synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q7U4S6 4.88e-157 451 57 8 396 3 metK S-adenosylmethionine synthase Parasynechococcus marenigrum (strain WH8102)
Q8CXS7 5.77e-157 449 61 4 380 3 metK S-adenosylmethionine synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72SM5 5.77e-157 449 61 4 380 3 metK S-adenosylmethionine synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
C0QXK7 1.18e-156 449 57 2 390 3 metK S-adenosylmethionine synthase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
C5CD66 1.26e-156 449 55 3 396 3 metK S-adenosylmethionine synthase Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
Q741G5 1.58e-156 449 58 5 397 3 metK S-adenosylmethionine synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A5GJ24 1.61e-156 449 56 8 408 3 metK S-adenosylmethionine synthase Synechococcus sp. (strain WH7803)
B3QMF6 2.39e-156 449 59 7 401 3 metK S-adenosylmethionine synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B0CG96 3.44e-156 449 55 6 406 3 metK S-adenosylmethionine synthase Acaryochloris marina (strain MBIC 11017)
Q2J8P2 4.44e-156 448 57 7 403 3 metK1 S-adenosylmethionine synthase 1 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q3AME2 5.38e-156 448 56 9 409 3 metK S-adenosylmethionine synthase Synechococcus sp. (strain CC9605)
C1AN37 6.25e-156 447 59 7 397 3 metK S-adenosylmethionine synthase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KII1 6.25e-156 447 59 7 397 3 metK S-adenosylmethionine synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10320
Feature type CDS
Gene metK
Product methionine adenosyltransferase
Location 2263980 - 2265134 (strand: 1)
Length 1155 (nucleotides) / 384 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_949
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00438 S-adenosylmethionine synthetase, N-terminal domain
PF02772 S-adenosylmethionine synthetase, central domain
PF02773 S-adenosylmethionine synthetase, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0192 Coenzyme transport and metabolism (H) H S-adenosylmethionine synthetase

Kegg Ortholog Annotation(s)

Protein Sequence

MTTHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEITTKAWVDIEEITRKTVREIGYTSSDMGFDANSCAVISAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAQVRKNGTLPWLRPDAKSQITFQYDNNNIVGIDAVVLSTQHAEDISQKDLHEAVMEEIIKPILPTEWLNEQTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKIPTSQLILLVREFFDLRPYGLIQMLDLLHPIYQKTAAYGHFGRAEFPWEATDKAEILREAAGLK

Flanking regions ( +/- flanking 50bp)

ATGTTAAAACATCCATCCTTAGACCATCTGTATTAAGGTAACGAGATATAATGACTACACACCTTTTTACTTCTGAATCAGTATCAGAAGGTCATCCAGACAAAATTGCGGATCAAATTTCTGATGCCGTATTGGATGCAATTTTAGAACAAGATCCAAAAGCACGTGTTGCCTGTGAAACTTACGTTAAAACAGGCATGGTGATGGTAGGCGGAGAAATTACCACCAAAGCTTGGGTTGATATCGAAGAGATCACACGTAAAACAGTACGTGAAATCGGTTATACCAGTTCAGATATGGGCTTTGATGCTAATTCCTGCGCCGTTATCAGTGCGATTGGTAAACAATCCCCAGATATCAACCAAGGTGTTGACCGCGCAGATCCCCTTGAACAAGGTGCCGGTGACCAAGGCTTAATGTTTGGTTATGCCACTAATGAAACTGACGTTCTGATGCCAGCGCCTATTACTTATGCTCACCGCTTAGTCCAGCGCCAAGCTCAAGTACGTAAAAATGGCACACTACCATGGTTACGTCCAGATGCTAAAAGCCAGATCACTTTCCAATACGACAATAACAACATTGTTGGTATTGATGCCGTGGTTTTATCAACTCAGCATGCTGAAGATATTTCACAAAAAGACTTACATGAAGCGGTAATGGAAGAGATCATTAAACCTATTCTGCCAACAGAATGGTTAAATGAACAAACCAAATATTTCATTAACCCAACAGGTCGTTTTGTTATCGGTGGCCCAATGGGCGACTGTGGATTAACAGGTCGTAAGATCATTGTTGATACTTATGGTGGTATGGCACGCCACGGCGGTGGGGCATTCTCTGGTAAAGATCCTTCCAAAGTTGACCGTTCTGCGGCTTATGCTGCACGTTATGTTGCAAAAAATATTGTTGCTGCGGGCTTAGCAGATCGCTGTGAAATTCAAGTGTCTTACGCTATCGGTGTTGCAGAGCCAACATCTATTATGGTCGAAACATTTGGCACTGAAAAAATCCCTACTTCACAACTGATCTTATTAGTACGTGAATTCTTTGATTTACGCCCTTATGGCTTAATTCAAATGCTGGATTTACTGCATCCGATCTACCAAAAAACAGCAGCATACGGTCATTTTGGTCGTGCTGAATTCCCTTGGGAAGCAACAGATAAAGCTGAGATTTTACGTGAAGCTGCGGGTTTAAAATAAATTTCCCTTGTTTCATAGCAAACTCATTAAACCACATCTTTTAGGTGTGG