Homologs in group_880

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04525 FBDBKF_04525 100.0 Morganella morganii S1 metK methionine adenosyltransferase
NLDBIP_06135 NLDBIP_06135 100.0 Morganella morganii S4 metK methionine adenosyltransferase
LHKJJB_03015 LHKJJB_03015 100.0 Morganella morganii S3 metK methionine adenosyltransferase
HKOGLL_06490 HKOGLL_06490 100.0 Morganella morganii S5 metK methionine adenosyltransferase
F4V73_RS08965 F4V73_RS08965 94.8 Morganella psychrotolerans metK methionine adenosyltransferase
PMI_RS10320 PMI_RS10320 92.2 Proteus mirabilis HI4320 metK methionine adenosyltransferase

Distribution of the homologs in the orthogroup group_880

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_880

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1A5 0.0 741 92 0 384 3 metK S-adenosylmethionine synthase Proteus mirabilis (strain HI4320)
Q7N119 0.0 729 89 0 384 3 metK S-adenosylmethionine synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A9MRD1 0.0 726 90 0 384 3 metK S-adenosylmethionine synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7LPQ9 0.0 725 90 0 384 3 metK S-adenosylmethionine synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A6TDV1 0.0 724 90 0 384 3 metK S-adenosylmethionine synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XUA8 0.0 724 90 0 384 3 metK S-adenosylmethionine synthase Klebsiella pneumoniae (strain 342)
Q3YXS9 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Shigella sonnei (strain Ss046)
P0A820 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Shigella flexneri
Q0T0V0 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Shigella flexneri serotype 5b (strain 8401)
Q32C11 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Shigella dysenteriae serotype 1 (strain Sd197)
B1LDF1 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain SMS-3-5 / SECEC)
B6I780 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain SE11)
B7N7J5 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A817 0.0 723 90 0 384 1 metK S-adenosylmethionine synthase Escherichia coli (strain K12)
B1IT65 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A818 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TDR0 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A481 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O9:H4 (strain HS)
B1XFA4 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain K12 / DH10B)
C5A0L1 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LYX2 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O8 (strain IAI1)
B7NI05 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQD9 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A819 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O157:H7
B7LFK4 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain 55989 / EAEC)
B7UHY9 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZR64 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
A8APG1 0.0 723 89 0 384 3 metK S-adenosylmethionine synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4WE78 0.0 723 90 0 384 3 metK S-adenosylmethionine synthase Enterobacter sp. (strain 638)
B2VF06 0.0 721 89 0 384 3 metK S-adenosylmethionine synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q31WK4 0.0 721 89 0 384 3 metK S-adenosylmethionine synthase Shigella boydii serotype 4 (strain Sb227)
B2U0W2 0.0 721 89 0 384 3 metK S-adenosylmethionine synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A7MJQ6 0.0 721 89 0 384 3 metK S-adenosylmethionine synthase Cronobacter sakazakii (strain ATCC BAA-894)
P66764 0.0 720 89 0 384 3 metK S-adenosylmethionine synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66765 0.0 720 89 0 384 3 metK S-adenosylmethionine synthase Salmonella typhi
B4TV58 0.0 720 89 0 384 3 metK S-adenosylmethionine synthase Salmonella schwarzengrund (strain CVM19633)
B5BFP7 0.0 720 89 0 384 3 metK S-adenosylmethionine synthase Salmonella paratyphi A (strain AKU_12601)
Q5PJJ2 0.0 720 89 0 384 3 metK S-adenosylmethionine synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T5J6 0.0 720 89 0 384 3 metK S-adenosylmethionine synthase Salmonella newport (strain SL254)
B5QY66 0.0 720 89 0 384 3 metK S-adenosylmethionine synthase Salmonella enteritidis PT4 (strain P125109)
Q57K26 0.0 720 89 0 384 3 metK S-adenosylmethionine synthase Salmonella choleraesuis (strain SC-B67)
B4THH4 0.0 719 89 0 384 3 metK S-adenosylmethionine synthase Salmonella heidelberg (strain SL476)
B5F5L4 0.0 719 89 0 384 3 metK S-adenosylmethionine synthase Salmonella agona (strain SL483)
B5FUK0 0.0 718 89 0 384 3 metK S-adenosylmethionine synthase Salmonella dublin (strain CT_02021853)
B1JNQ2 0.0 717 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q666P5 0.0 717 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TI83 0.0 717 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pestis (strain Pestoides F)
Q1CEX6 0.0 717 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R314 0.0 717 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZHG7 0.0 717 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pestis
B2K0S7 0.0 717 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CB69 0.0 717 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FEZ7 0.0 717 89 0 384 3 metK S-adenosylmethionine synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JPS4 0.0 715 89 0 384 3 metK S-adenosylmethionine synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B5RE50 0.0 715 89 0 384 3 metK S-adenosylmethionine synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q6D081 0.0 713 91 0 383 3 metK S-adenosylmethionine synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8GIX9 0.0 712 89 0 384 3 metK S-adenosylmethionine synthase Serratia proteamaculans (strain 568)
C6DFI3 0.0 709 91 0 383 3 metK S-adenosylmethionine synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q2NRD1 0.0 687 85 1 385 3 metK S-adenosylmethionine synthase Sodalis glossinidius (strain morsitans)
C5BAV4 0.0 686 88 0 384 3 metK S-adenosylmethionine synthase Edwardsiella ictaluri (strain 93-146)
Q087Q9 0.0 684 85 0 383 3 metK S-adenosylmethionine synthase Shewanella frigidimarina (strain NCIMB 400)
Q8EIB4 0.0 681 85 0 383 3 metK S-adenosylmethionine synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1RN71 0.0 680 84 0 383 3 metK S-adenosylmethionine synthase Shewanella sp. (strain W3-18-1)
Q0HRM1 0.0 680 85 0 383 3 metK S-adenosylmethionine synthase Shewanella sp. (strain MR-7)
Q0HM65 0.0 680 85 0 383 3 metK S-adenosylmethionine synthase Shewanella sp. (strain MR-4)
A0L0K9 0.0 680 85 0 383 3 metK S-adenosylmethionine synthase Shewanella sp. (strain ANA-3)
Q12QA6 0.0 680 85 0 383 3 metK S-adenosylmethionine synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A4Y3R7 0.0 680 84 0 383 3 metK S-adenosylmethionine synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A3QAX5 0.0 679 84 0 383 3 metK S-adenosylmethionine synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A9L1M6 0.0 679 85 0 383 3 metK S-adenosylmethionine synthase Shewanella baltica (strain OS195)
A6WS79 0.0 679 85 0 383 3 metK S-adenosylmethionine synthase Shewanella baltica (strain OS185)
B8E5U7 0.0 679 85 0 383 3 metK S-adenosylmethionine synthase Shewanella baltica (strain OS223)
A3D0T8 0.0 677 85 0 383 3 metK S-adenosylmethionine synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A8FRL1 0.0 676 83 0 383 3 metK S-adenosylmethionine synthase Shewanella sediminis (strain HAW-EB3)
A1S9A6 0.0 670 83 0 383 3 metK S-adenosylmethionine synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B8CU43 0.0 669 83 1 384 3 metK S-adenosylmethionine synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q15QK1 0.0 665 83 0 383 3 metK S-adenosylmethionine synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q3IDQ1 0.0 664 83 0 383 3 metK S-adenosylmethionine synthase Pseudoalteromonas translucida (strain TAC 125)
A8H0M7 0.0 663 82 1 384 3 metK S-adenosylmethionine synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B1KF18 0.0 662 82 1 384 3 metK S-adenosylmethionine synthase Shewanella woodyi (strain ATCC 51908 / MS32)
A1SZJ9 0.0 661 83 0 381 3 metK S-adenosylmethionine synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A5UIU0 0.0 660 83 0 384 3 metK S-adenosylmethionine synthase Haemophilus influenzae (strain PittGG)
Q4QLC5 0.0 660 83 0 384 3 metK S-adenosylmethionine synthase Haemophilus influenzae (strain 86-028NP)
P43762 0.0 659 83 0 384 3 metK S-adenosylmethionine synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UCT6 0.0 659 83 0 384 3 metK S-adenosylmethionine synthase Haemophilus influenzae (strain PittEE)
A6VMK8 0.0 657 83 0 383 3 metK S-adenosylmethionine synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P57897 0.0 657 83 0 384 3 metK S-adenosylmethionine synthase Pasteurella multocida (strain Pm70)
C4K3W7 0.0 655 81 0 384 3 metK S-adenosylmethionine synthase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B0TUB8 0.0 654 82 1 384 3 metK S-adenosylmethionine synthase Shewanella halifaxensis (strain HAW-EB4)
Q65UT4 0.0 651 82 0 383 3 metK S-adenosylmethionine synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B4RWC7 0.0 650 82 0 378 3 metK S-adenosylmethionine synthase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
C3LRY9 0.0 650 83 0 381 3 metK S-adenosylmethionine synthase Vibrio cholerae serotype O1 (strain M66-2)
A5F9H4 0.0 650 83 0 381 3 metK S-adenosylmethionine synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KUP3 0.0 649 83 0 381 3 metK S-adenosylmethionine synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A3N186 0.0 649 83 0 383 3 metK S-adenosylmethionine synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BQ17 0.0 649 83 0 383 3 metK S-adenosylmethionine synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H1W3 0.0 649 83 0 383 3 metK S-adenosylmethionine synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0UWT3 0.0 648 81 0 384 3 metK S-adenosylmethionine synthase Histophilus somni (strain 2336)
Q0I559 0.0 648 81 0 384 3 metK S-adenosylmethionine synthase Histophilus somni (strain 129Pt)
Q7MHK6 0.0 647 83 0 384 3 metK S-adenosylmethionine synthase Vibrio vulnificus (strain YJ016)
Q8DCA3 0.0 647 83 0 384 3 metK S-adenosylmethionine synthase Vibrio vulnificus (strain CMCP6)
Q87LK6 0.0 645 82 0 384 3 metK S-adenosylmethionine synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1LU70 0.0 643 79 0 381 3 metK S-adenosylmethionine synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
B8F4B2 0.0 641 82 0 380 3 metK S-adenosylmethionine synthase Glaesserella parasuis serovar 5 (strain SH0165)
Q6LMM8 0.0 639 82 0 384 3 metK S-adenosylmethionine synthase Photobacterium profundum (strain SS9)
Q7VNG7 0.0 634 81 0 380 3 metK S-adenosylmethionine synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A7MTQ7 0.0 632 80 0 384 3 metK S-adenosylmethionine synthase Vibrio campbellii (strain ATCC BAA-1116)
Q8K9E5 0.0 631 77 0 377 3 metK S-adenosylmethionine synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B6EMV8 0.0 630 80 0 384 3 metK S-adenosylmethionine synthase Aliivibrio salmonicida (strain LFI1238)
Q5QVM7 0.0 628 78 0 378 3 metK S-adenosylmethionine synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B5F9T2 0.0 626 80 0 384 3 metK S-adenosylmethionine synthase Aliivibrio fischeri (strain MJ11)
Q5E7R2 0.0 626 80 0 384 3 metK S-adenosylmethionine synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B8D7U1 0.0 624 75 0 377 3 metK S-adenosylmethionine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57486 0.0 624 75 0 377 3 metK S-adenosylmethionine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9I9 0.0 624 75 0 377 3 metK S-adenosylmethionine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B7VKB3 0.0 620 79 0 383 3 metK S-adenosylmethionine synthase Vibrio atlanticus (strain LGP32)
A6W3D6 0.0 620 79 2 382 3 metK S-adenosylmethionine synthase Marinomonas sp. (strain MWYL1)
Q60CG7 0.0 607 76 1 384 3 metK S-adenosylmethionine synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8D2N8 0.0 604 71 0 384 3 metK S-adenosylmethionine synthase Wigglesworthia glossinidia brevipalpis
Q31EL0 0.0 602 75 1 385 3 metK S-adenosylmethionine synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q0A6D3 0.0 602 72 1 385 3 metK S-adenosylmethionine synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B1J2Z8 0.0 602 73 2 391 3 metK S-adenosylmethionine synthase Pseudomonas putida (strain W619)
Q1I3X6 0.0 600 73 2 391 3 metK S-adenosylmethionine synthase Pseudomonas entomophila (strain L48)
Q486L6 0.0 598 71 1 395 3 metK S-adenosylmethionine synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q88D60 0.0 597 72 2 391 3 metK S-adenosylmethionine synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KLZ1 0.0 597 72 2 391 3 metK S-adenosylmethionine synthase Pseudomonas putida (strain GB-1)
A5WA00 0.0 597 72 2 391 3 metK S-adenosylmethionine synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A4XPF8 0.0 596 74 2 391 3 metK S-adenosylmethionine synthase Pseudomonas mendocina (strain ymp)
Q3K5E8 0.0 591 72 2 391 3 metK S-adenosylmethionine synthase Pseudomonas fluorescens (strain Pf0-1)
A1U547 0.0 591 71 1 392 3 metK S-adenosylmethionine synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
C3K3F5 0.0 590 72 1 391 3 metK S-adenosylmethionine synthase Pseudomonas fluorescens (strain SBW25)
Q9I5Z0 0.0 590 72 1 391 3 metK S-adenosylmethionine synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02TL9 0.0 590 72 1 391 3 metK S-adenosylmethionine synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V4D3 0.0 590 72 1 391 3 metK S-adenosylmethionine synthase Pseudomonas aeruginosa (strain LESB58)
A6UZ09 0.0 590 72 1 391 3 metK S-adenosylmethionine synthase Pseudomonas aeruginosa (strain PA7)
Q4K4I7 0.0 588 72 2 391 3 metK S-adenosylmethionine synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C1DKE3 0.0 588 71 1 391 3 metK S-adenosylmethionine synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B0RV66 0.0 585 69 2 403 3 metK S-adenosylmethionine synthase Xanthomonas campestris pv. campestris (strain B100)
Q4UR08 0.0 585 69 2 403 3 metK S-adenosylmethionine synthase Xanthomonas campestris pv. campestris (strain 8004)
Q1R0L1 0.0 585 70 2 401 3 metK S-adenosylmethionine synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q8PCH3 0.0 583 68 2 403 3 metK S-adenosylmethionine synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
A4VRE8 0.0 583 71 1 391 3 metK S-adenosylmethionine synthase Stutzerimonas stutzeri (strain A1501)
Q1QCH2 0.0 581 72 1 384 3 metK S-adenosylmethionine synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q5ZTY6 0.0 581 72 0 377 3 metK S-adenosylmethionine synthase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IDK5 0.0 581 72 0 377 3 metK S-adenosylmethionine synthase Legionella pneumophila (strain Corby)
Q5X3N0 0.0 581 72 0 377 3 metK S-adenosylmethionine synthase Legionella pneumophila (strain Paris)
Q3J7R5 0.0 580 72 2 382 3 metK S-adenosylmethionine synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
C5BTQ4 0.0 580 73 1 378 3 metK S-adenosylmethionine synthase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q5WV18 0.0 580 72 0 377 3 metK S-adenosylmethionine synthase Legionella pneumophila (strain Lens)
Q4FTH7 0.0 579 72 1 384 3 metK S-adenosylmethionine synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A9N9E2 0.0 578 72 1 383 3 metK S-adenosylmethionine synthase Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD87 0.0 578 72 1 383 3 metK S-adenosylmethionine synthase Coxiella burnetii (strain Dugway 5J108-111)
B6J3Q9 0.0 578 72 1 383 3 metK S-adenosylmethionine synthase Coxiella burnetii (strain CbuG_Q212)
Q9PGB0 0.0 577 69 2 403 3 metK S-adenosylmethionine synthase Xylella fastidiosa (strain 9a5c)
Q83A78 0.0 577 71 1 383 3 metK S-adenosylmethionine synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
B6J6H0 0.0 577 72 1 383 3 metK S-adenosylmethionine synthase Coxiella burnetii (strain CbuK_Q154)
A5EY13 0.0 575 73 1 382 3 metK S-adenosylmethionine synthase Dichelobacter nodosus (strain VCS1703A)
B0U4E7 0.0 575 69 2 403 3 metK S-adenosylmethionine synthase Xylella fastidiosa (strain M12)
B3PGF2 0.0 575 72 1 378 3 metK S-adenosylmethionine synthase Cellvibrio japonicus (strain Ueda107)
Q6FAQ6 0.0 575 72 1 383 3 metK S-adenosylmethionine synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q0VL83 0.0 574 73 0 376 3 metK S-adenosylmethionine synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q5GW76 0.0 573 69 2 390 3 metK S-adenosylmethionine synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SPP5 0.0 573 69 2 390 3 metK S-adenosylmethionine synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZF1 0.0 573 69 2 390 3 metK S-adenosylmethionine synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BXB7 0.0 573 69 2 390 3 metK S-adenosylmethionine synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PP75 0.0 573 69 2 390 3 metK S-adenosylmethionine synthase Xanthomonas axonopodis pv. citri (strain 306)
Q2SLT3 0.0 572 71 1 381 3 metK S-adenosylmethionine synthase Hahella chejuensis (strain KCTC 2396)
Q21NJ5 0.0 572 72 1 376 3 metK S-adenosylmethionine synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q87AY6 0.0 570 68 2 403 3 metK S-adenosylmethionine synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I898 0.0 570 68 2 403 3 metK S-adenosylmethionine synthase Xylella fastidiosa (strain M23)
Q7WYG5 0.0 569 71 0 380 3 metK S-adenosylmethionine synthase Legionella jeonii
Q6AQ43 0.0 568 70 2 387 3 metK S-adenosylmethionine synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A5WDU0 0.0 566 71 1 383 3 metK S-adenosylmethionine synthase Psychrobacter sp. (strain PRwf-1)
Q4ZM01 0.0 565 70 1 379 3 metK S-adenosylmethionine synthase Pseudomonas syringae pv. syringae (strain B728a)
Q88AK7 0.0 565 70 1 379 3 metK S-adenosylmethionine synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q493F2 0.0 565 71 1 386 3 metK S-adenosylmethionine synthase Blochmanniella pennsylvanica (strain BPEN)
Q48CH3 0.0 563 70 1 379 3 metK S-adenosylmethionine synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B2FPC7 0.0 562 69 3 390 3 metK S-adenosylmethionine synthase Stenotrophomonas maltophilia (strain K279a)
B4SK03 0.0 561 69 3 390 3 metK S-adenosylmethionine synthase Stenotrophomonas maltophilia (strain R551-3)
B0VC98 0.0 559 72 1 383 3 metK S-adenosylmethionine synthase Acinetobacter baumannii (strain AYE)
A3M4V2 0.0 558 72 1 383 3 metK S-adenosylmethionine synthase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VR30 0.0 558 72 1 383 3 metK S-adenosylmethionine synthase Acinetobacter baumannii (strain SDF)
B2HYY9 0.0 558 72 1 383 3 metK S-adenosylmethionine synthase Acinetobacter baumannii (strain ACICU)
Q3SFY2 0.0 546 68 2 383 3 metK S-adenosylmethionine synthase Thiobacillus denitrificans (strain ATCC 25259)
A8GPW6 0.0 546 68 1 380 3 metK S-adenosylmethionine synthase Rickettsia akari (strain Hartford)
B5EN11 0.0 545 70 2 386 3 metK S-adenosylmethionine synthase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J551 0.0 545 70 2 386 3 metK S-adenosylmethionine synthase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q7VRG5 0.0 540 68 2 385 3 metK S-adenosylmethionine synthase Blochmanniella floridana
Q3AFS4 0.0 537 65 3 396 3 metK S-adenosylmethionine synthase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q0AEV7 0.0 533 69 2 387 3 metK S-adenosylmethionine synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q1LS34 0.0 533 69 3 383 3 metK S-adenosylmethionine synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q476V0 0.0 531 69 3 383 3 metK S-adenosylmethionine synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q7VUL5 0.0 530 68 2 381 3 metK S-adenosylmethionine synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W200 0.0 530 68 2 381 3 metK S-adenosylmethionine synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WQX8 0.0 530 68 2 381 3 metK S-adenosylmethionine synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q5KW02 0.0 529 66 3 392 3 metK S-adenosylmethionine synthase Geobacillus kaustophilus (strain HTA426)
P56878 0.0 529 66 1 380 3 metK S-adenosylmethionine synthase Rickettsia prowazekii (strain Madrid E)
A9KL72 0.0 529 65 3 389 3 metK S-adenosylmethionine synthase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q21RM4 0.0 529 68 3 388 3 metK S-adenosylmethionine synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q9RL99 0.0 528 66 1 380 3 metK S-adenosylmethionine synthase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q2Y5Z1 0.0 528 66 2 388 3 metK S-adenosylmethionine synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A2SKW6 0.0 528 69 4 388 3 metK S-adenosylmethionine synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A9IH21 0.0 528 67 2 381 3 metK S-adenosylmethionine synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A6T2Z1 0.0 527 69 3 384 3 metK S-adenosylmethionine synthase Janthinobacterium sp. (strain Marseille)
A1K301 0.0 527 68 2 383 3 metK S-adenosylmethionine synthase Azoarcus sp. (strain BH72)
A5CYJ7 0.0 526 64 3 396 3 metK S-adenosylmethionine synthase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q82WL2 0.0 526 68 2 387 3 metK S-adenosylmethionine synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B1Y6S3 0.0 526 68 3 388 3 metK S-adenosylmethionine synthase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
C5D6E9 0.0 525 65 3 392 3 metK S-adenosylmethionine synthase Geobacillus sp. (strain WCH70)
B8FSB9 0.0 525 63 3 396 3 metK S-adenosylmethionine synthase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A4IRZ1 0.0 525 65 3 392 3 metK S-adenosylmethionine synthase Geobacillus thermodenitrificans (strain NG80-2)
Q47JN4 0.0 520 69 2 387 3 metK S-adenosylmethionine synthase Dechloromonas aromatica (strain RCB)
Q5NIC7 0.0 520 67 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JT0 0.0 520 67 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. tularensis (strain FSC 198)
Q7NZF9 0.0 520 69 3 389 3 metK S-adenosylmethionine synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0BKD0 0.0 520 67 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. holarctica (strain OSU18)
A0Q862 0.0 520 67 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. novicida (strain U112)
B2SFE1 0.0 520 67 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A1N2 0.0 520 67 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. holarctica (strain LVS)
A7NEB4 0.0 520 67 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B0TX15 0.0 520 66 1 383 3 metK S-adenosylmethionine synthase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q0KF39 0.0 520 69 3 383 3 metK S-adenosylmethionine synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A9BXF7 0.0 519 68 4 389 3 metK S-adenosylmethionine synthase Delftia acidovorans (strain DSM 14801 / SPH-1)
A1VK01 0.0 519 67 5 391 3 metK S-adenosylmethionine synthase Polaromonas naphthalenivorans (strain CJ2)
Q5FAC0 0.0 518 68 3 389 1 metK S-adenosylmethionine synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B4RQ36 0.0 516 68 3 389 3 metK S-adenosylmethionine synthase Neisseria gonorrhoeae (strain NCCP11945)
A4IWA4 0.0 516 66 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. tularensis (strain WY96-3418)
B9MDD1 0.0 516 68 4 389 3 metK S-adenosylmethionine synthase Acidovorax ebreus (strain TPSY)
C1DCT7 0.0 515 69 3 389 3 metK S-adenosylmethionine synthase Laribacter hongkongensis (strain HLHK9)
A1W3X4 0.0 515 68 4 389 3 metK S-adenosylmethionine synthase Acidovorax sp. (strain JS42)
A1TKT9 0.0 515 68 4 389 3 metK S-adenosylmethionine synthase Paracidovorax citrulli (strain AAC00-1)
Q12FG9 0.0 514 68 4 378 3 metK S-adenosylmethionine synthase Polaromonas sp. (strain JS666 / ATCC BAA-500)
B2T1P7 0.0 514 69 2 383 3 metK S-adenosylmethionine synthase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A4JIQ4 0.0 513 69 2 385 3 metK S-adenosylmethionine synthase Burkholderia vietnamiensis (strain G4 / LMG 22486)
C5CQF1 0.0 513 68 4 389 3 metK S-adenosylmethionine synthase Variovorax paradoxus (strain S110)
Q0BAY8 0.0 513 69 2 385 3 metK S-adenosylmethionine synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YPQ4 0.0 513 69 2 385 3 metK S-adenosylmethionine synthase Burkholderia ambifaria (strain MC40-6)
P54419 0.0 513 63 4 391 3 metK S-adenosylmethionine synthase Bacillus subtilis (strain 168)
Q1BSN9 0.0 512 69 2 385 3 metK S-adenosylmethionine synthase Burkholderia orbicola (strain AU 1054)
B1K0F2 0.0 512 69 2 385 3 metK S-adenosylmethionine synthase Burkholderia orbicola (strain MC0-3)
A0KBF2 0.0 512 69 2 385 3 metK S-adenosylmethionine synthase Burkholderia cenocepacia (strain HI2424)
A8FGH7 0.0 512 63 3 392 3 metK S-adenosylmethionine synthase Bacillus pumilus (strain SAFR-032)
Q146W0 0.0 512 69 2 383 3 metK S-adenosylmethionine synthase Paraburkholderia xenovorans (strain LB400)
B2JJY6 0.0 512 69 2 383 3 metK S-adenosylmethionine synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q8Y347 0.0 511 69 3 383 3 metK S-adenosylmethionine synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2T267 0.0 511 69 2 385 3 metK S-adenosylmethionine synthase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q39BZ1 0.0 511 69 2 385 3 metK S-adenosylmethionine synthase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4E800 0.0 511 69 2 385 3 metK S-adenosylmethionine synthase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A4G977 0.0 511 69 3 373 3 metK S-adenosylmethionine synthase Herminiimonas arsenicoxydans
A1KS98 0.0 510 68 3 389 3 metK S-adenosylmethionine synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A9M1V8 0.0 510 68 3 389 3 metK S-adenosylmethionine synthase Neisseria meningitidis serogroup C (strain 053442)
Q1H4X2 1.58e-180 509 68 2 377 3 metK S-adenosylmethionine synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q9JY09 1.82e-180 509 68 3 389 3 metK S-adenosylmethionine synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B2UD22 2.31e-180 509 68 3 383 3 metK S-adenosylmethionine synthase Ralstonia pickettii (strain 12J)
Q9JVV6 2.52e-180 509 68 3 389 3 metK S-adenosylmethionine synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q63YH5 2.56e-180 509 68 2 385 1 metK S-adenosylmethionine synthase Burkholderia pseudomallei (strain K96243)
A3N4I1 2.56e-180 509 68 2 385 3 metK S-adenosylmethionine synthase Burkholderia pseudomallei (strain 668)
Q3JX94 2.56e-180 509 68 2 385 3 metK S-adenosylmethionine synthase Burkholderia pseudomallei (strain 1710b)
A3NQ73 2.56e-180 509 68 2 385 3 metK S-adenosylmethionine synthase Burkholderia pseudomallei (strain 1106a)
A1V7L5 2.56e-180 509 68 2 385 3 metK S-adenosylmethionine synthase Burkholderia mallei (strain SAVP1)
Q62EZ1 2.56e-180 509 68 2 385 3 metK S-adenosylmethionine synthase Burkholderia mallei (strain ATCC 23344)
A2S860 2.56e-180 509 68 2 385 3 metK S-adenosylmethionine synthase Burkholderia mallei (strain NCTC 10229)
A3MRQ4 2.56e-180 509 68 2 385 3 metK S-adenosylmethionine synthase Burkholderia mallei (strain NCTC 10247)
Q2RK28 2.59e-180 509 63 3 395 3 metK S-adenosylmethionine synthase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q5P2V5 3.42e-180 508 66 2 384 3 metK S-adenosylmethionine synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A7Z7Y9 4.49e-180 508 63 3 391 3 metK S-adenosylmethionine synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A3DHM4 7.53e-180 508 62 3 394 3 metK S-adenosylmethionine synthase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A4T0F0 8.19e-180 508 68 2 384 3 metK S-adenosylmethionine synthase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A1WSC8 1.52e-179 507 66 4 389 3 metK S-adenosylmethionine synthase Verminephrobacter eiseniae (strain EF01-2)
Q38YF8 1.98e-179 507 63 4 387 3 metK S-adenosylmethionine synthase Latilactobacillus sakei subsp. sakei (strain 23K)
Q65FV8 2.53e-179 507 63 3 392 3 metK S-adenosylmethionine synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B9MQ10 3.15e-179 506 63 4 393 3 metK S-adenosylmethionine synthase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A7GU40 4.04e-179 506 63 3 394 3 metK S-adenosylmethionine synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q8EP05 6.17e-179 506 64 3 388 3 metK S-adenosylmethionine synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9K7Q9 6.53e-179 506 62 3 391 3 metK S-adenosylmethionine synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q3A388 7.49e-179 505 63 2 387 3 metK S-adenosylmethionine synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q5WDZ8 8.35e-179 506 62 3 390 3 metK S-adenosylmethionine synthase Shouchella clausii (strain KSM-K16)
B1XSH9 1.73e-178 504 67 2 384 3 metK S-adenosylmethionine synthase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
B8I4C1 2.21e-178 504 61 3 398 3 metK S-adenosylmethionine synthase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A2RN40 2.32e-178 504 63 4 394 3 metK S-adenosylmethionine synthase Lactococcus lactis subsp. cremoris (strain MG1363)
B7IL28 3.68e-178 504 63 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain G9842)
Q9CEE0 5.1e-178 503 63 4 394 3 metK S-adenosylmethionine synthase Lactococcus lactis subsp. lactis (strain IL1403)
P50307 6.67e-178 503 62 4 389 3 metK S-adenosylmethionine synthase Staphylococcus aureus
Q632S5 9.62e-178 503 62 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain ZK / E33L)
B9J265 9.62e-178 503 62 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain Q1)
B7JT32 9.62e-178 503 62 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain AH820)
Q81KI0 9.62e-178 503 62 3 394 3 metK S-adenosylmethionine synthase Bacillus anthracis
C3LAZ9 9.62e-178 503 62 3 394 3 metK S-adenosylmethionine synthase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PCC4 9.62e-178 503 62 3 394 3 metK S-adenosylmethionine synthase Bacillus anthracis (strain A0248)
Q6HCB4 1.13e-177 503 62 3 394 3 metK S-adenosylmethionine synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
B7HSV6 1.13e-177 503 62 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain AH187)
P61946 1.15e-177 502 62 2 387 3 metK S-adenosylmethionine synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q816Q8 1.35e-177 502 62 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7H9C7 1.35e-177 502 62 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain B4264)
Q8NVZ9 1.71e-177 502 62 4 389 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain MW2)
A8Z4L2 1.71e-177 502 62 4 389 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G8E3 1.71e-177 502 62 4 389 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain MSSA476)
A6QHX0 1.71e-177 502 62 4 389 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain Newman)
Q5HEY9 1.71e-177 502 62 4 389 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain COL)
Q2YTK1 1.71e-177 502 62 4 389 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G1W4 1.71e-177 502 62 4 389 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFV6 1.71e-177 502 62 4 389 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain USA300)
C6E2L2 1.89e-177 501 62 2 387 3 metK S-adenosylmethionine synthase Geobacter sp. (strain M21)
Q72YV6 1.9e-177 502 62 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
C1EW36 2e-177 502 62 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain 03BB102)
A0RJZ7 2e-177 502 62 3 394 3 metK S-adenosylmethionine synthase Bacillus thuringiensis (strain Al Hakam)
Q02WN8 2.39e-177 501 63 4 390 3 metK S-adenosylmethionine synthase Lactococcus lactis subsp. cremoris (strain SK11)
A9VLC6 2.41e-177 501 62 3 394 3 metK S-adenosylmethionine synthase Bacillus mycoides (strain KBAB4)
B9DN19 2.46e-177 501 62 4 390 3 metK S-adenosylmethionine synthase Staphylococcus carnosus (strain TM300)
Q39W48 2.71e-177 501 62 2 387 3 metK S-adenosylmethionine synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q6GFR6 5.33e-177 501 62 4 389 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain MRSA252)
A5GA66 5.51e-177 500 62 2 387 3 metK S-adenosylmethionine synthase Geotalea uraniireducens (strain Rf4)
Q67T90 5.9e-177 501 62 2 391 3 metK S-adenosylmethionine synthase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P66767 6.16e-177 501 62 4 389 1 metK S-adenosylmethionine synthase Staphylococcus aureus (strain N315)
P66766 6.16e-177 501 62 4 389 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ITV6 6.16e-177 501 62 4 389 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain JH9)
A6U2Q1 6.16e-177 501 62 4 389 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain JH1)
A7X3N2 6.16e-177 501 62 4 389 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
A8MJT0 7.28e-177 500 61 3 395 3 metK S-adenosylmethionine synthase Alkaliphilus oremlandii (strain OhILAs)
A0LCX5 9.31e-177 500 63 3 386 3 metK S-adenosylmethionine synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q18CL7 1.1e-176 500 60 3 396 3 metK S-adenosylmethionine synthase Clostridioides difficile (strain 630)
A4XHT8 1.26e-176 499 62 4 393 3 metK S-adenosylmethionine synthase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B0KC73 3.12e-176 499 60 2 393 3 metK S-adenosylmethionine synthase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A4J945 5.02e-176 498 60 3 399 3 metK S-adenosylmethionine synthase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q0AXL1 1.61e-175 497 60 2 396 3 metK S-adenosylmethionine synthase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B9K7H2 2.18e-175 496 61 3 392 3 metK S-adenosylmethionine synthase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q7M7Z2 2.57e-175 496 62 2 382 3 metK S-adenosylmethionine synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B1I6C4 3.13e-175 496 60 3 391 3 metK S-adenosylmethionine synthase Desulforudis audaxviator (strain MP104C)
Q7VFY5 6.94e-175 495 63 2 384 3 metK S-adenosylmethionine synthase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A0LF65 4.03e-174 493 61 2 387 3 metK S-adenosylmethionine synthase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q837P9 4.76e-174 493 63 4 385 3 metK S-adenosylmethionine synthase Enterococcus faecalis (strain ATCC 700802 / V583)
B1LB17 5.68e-174 493 60 3 392 3 metK S-adenosylmethionine synthase Thermotoga sp. (strain RQ2)
A5ILS4 5.68e-174 493 60 3 392 3 metK S-adenosylmethionine synthase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9X1Y8 5.68e-174 493 60 3 392 3 metK S-adenosylmethionine synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q98A80 8.06e-174 492 63 2 382 3 metK S-adenosylmethionine synthase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q03QA4 1.19e-173 492 64 4 390 3 metK S-adenosylmethionine synthase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q49YL6 3.55e-173 491 61 3 389 3 metK S-adenosylmethionine synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q92AZ5 6.43e-173 490 62 6 396 3 metK S-adenosylmethionine synthase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q5FIN8 7.83e-173 490 61 4 391 3 metK S-adenosylmethionine synthase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q4L7C7 1.35e-172 489 61 4 389 3 metK S-adenosylmethionine synthase Staphylococcus haemolyticus (strain JCSC1435)
B8DFQ7 2.09e-172 489 62 6 396 3 metK S-adenosylmethionine synthase Listeria monocytogenes serotype 4a (strain HCC23)
Q71Z03 2.09e-172 489 62 6 396 3 metK S-adenosylmethionine synthase Listeria monocytogenes serotype 4b (strain F2365)
C1KVW3 2.09e-172 489 62 6 396 3 metK S-adenosylmethionine synthase Listeria monocytogenes serotype 4b (strain CLIP80459)
A0AJB9 7.04e-172 488 62 6 396 3 metK S-adenosylmethionine synthase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A8YWU7 7.95e-172 488 61 4 391 3 metK S-adenosylmethionine synthase Lactobacillus helveticus (strain DPC 4571)
Q8Y6M0 2.01e-171 486 62 6 396 3 metK S-adenosylmethionine synthase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q74KS4 4.75e-171 486 62 3 388 3 metK S-adenosylmethionine synthase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
B4ULF7 5.97e-171 485 64 3 381 3 metK S-adenosylmethionine synthase Anaeromyxobacter sp. (strain K)
A5UQL0 6.29e-171 486 61 3 394 3 metK S-adenosylmethionine synthase Roseiflexus sp. (strain RS-1)
A3CNY4 7.58e-171 485 61 4 389 3 metK S-adenosylmethionine synthase Streptococcus sanguinis (strain SK36)
B9LBJ9 8.23e-171 485 63 4 391 3 metK S-adenosylmethionine synthase Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WGQ3 8.23e-171 485 63 4 391 3 metK S-adenosylmethionine synthase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
B8J8T3 1.01e-170 484 64 3 381 3 metK S-adenosylmethionine synthase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A8AWW6 2.78e-170 484 61 4 388 3 metK S-adenosylmethionine synthase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q2IM98 3.23e-170 483 64 3 381 3 metK S-adenosylmethionine synthase Anaeromyxobacter dehalogenans (strain 2CP-C)
A8ZYC8 3.25e-170 483 62 2 385 3 metK S-adenosylmethionine synthase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
A7HJA9 6.67e-170 483 58 3 394 3 metK S-adenosylmethionine synthase Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Q8RCE4 8.56e-170 482 58 2 393 3 metK S-adenosylmethionine synthase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q88XB8 1.23e-169 482 63 4 387 1 metK S-adenosylmethionine synthase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A7NFR6 1.53e-169 482 60 3 394 3 metK S-adenosylmethionine synthase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
B6JPU7 2.05e-169 481 61 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain P12)
A9EXT3 2.87e-169 482 61 1 381 3 metK S-adenosylmethionine synthase Sorangium cellulosum (strain So ce56)
Q9ZMN5 3.17e-169 481 61 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain J99 / ATCC 700824)
B5Z9W8 3.5e-169 480 61 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain G27)
Q8DT23 1.05e-168 479 61 4 389 3 metK S-adenosylmethionine synthase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9L0Y3 1.05e-168 480 60 5 402 3 metK S-adenosylmethionine synthase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8DQH0 1.17e-168 479 60 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2INE5 1.17e-168 479 60 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain CGSP14)
B1IAT8 1.17e-168 479 60 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain Hungary19A-6)
B5E364 1.17e-168 479 60 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae serotype 19F (strain G54)
Q04LE0 1.17e-168 479 60 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B8ZNB7 1.47e-168 479 60 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
P56460 1.6e-168 479 61 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain ATCC 700392 / 26695)
B2US27 1.6e-168 479 61 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain Shi470)
Q8CNT5 2.1e-168 479 60 4 394 3 metK S-adenosylmethionine synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNB8 2.1e-168 479 60 4 394 3 metK S-adenosylmethionine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A4VWU8 2.87e-168 478 61 4 389 3 metK S-adenosylmethionine synthase Streptococcus suis (strain 05ZYH33)
A4W351 2.87e-168 478 61 4 389 3 metK S-adenosylmethionine synthase Streptococcus suis (strain 98HAH33)
C1C6A5 3.69e-168 478 60 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain 70585)
B2G8G3 4.19e-168 478 62 4 391 3 metK S-adenosylmethionine synthase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VL29 4.19e-168 478 62 4 391 3 metK S-adenosylmethionine synthase Limosilactobacillus reuteri (strain DSM 20016)
A7H6N1 8.32e-168 477 63 3 385 3 metK S-adenosylmethionine synthase Anaeromyxobacter sp. (strain Fw109-5)
Q17YQ7 8.89e-168 477 61 2 378 3 metK S-adenosylmethionine synthase Helicobacter acinonychis (strain Sheeba)
C1CJL0 9.04e-168 477 60 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain P1031)
Q5SHT8 1.18e-167 477 59 3 391 3 metK S-adenosylmethionine synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72I53 1.18e-167 477 59 3 391 1 metK S-adenosylmethionine synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B9DSM6 1.26e-167 477 60 4 390 3 metK S-adenosylmethionine synthase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
C1CQM2 1.43e-167 477 60 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain Taiwan19F-14)
Q97RN9 1.43e-167 477 60 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q1CUW4 1.55e-167 476 61 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain HPAG1)
Q0SR05 2.07e-167 476 60 2 387 3 metK S-adenosylmethionine synthase Clostridium perfringens (strain SM101 / Type A)
Q0TND4 2.07e-167 476 60 2 387 3 metK S-adenosylmethionine synthase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
C6C1U5 3.16e-167 476 61 1 382 3 metK S-adenosylmethionine synthase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A6Q1Z8 3.27e-167 475 60 2 377 3 metK S-adenosylmethionine synthase Nitratiruptor sp. (strain SB155-2)
B7IEV2 5.12e-167 475 58 4 390 3 metK S-adenosylmethionine synthase Thermosipho africanus (strain TCF52B)
C1CDB0 2.01e-166 474 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain JJA)
C4XPZ6 2.33e-166 473 62 1 379 3 metK S-adenosylmethionine synthase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q898W7 2.67e-166 473 60 2 385 3 metK S-adenosylmethionine synthase Clostridium tetani (strain Massachusetts / E88)
Q8E5Y0 3.49e-166 473 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus agalactiae serotype III (strain NEM316)
Q8E0A3 5.71e-166 473 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3K1M7 5.71e-166 473 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B2GDG2 6.91e-166 473 61 4 391 3 metK S-adenosylmethionine synthase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
A1SJF9 2.43e-165 471 62 6 385 3 metK S-adenosylmethionine synthase Nocardioides sp. (strain ATCC BAA-499 / JS614)
A9BHX2 3.03e-165 471 57 5 401 3 metK S-adenosylmethionine synthase Petrotoga mobilis (strain DSM 10674 / SJ95)
Q1WUT4 3.38e-165 471 64 4 388 3 metK S-adenosylmethionine synthase Ligilactobacillus salivarius (strain UCC118)
Q1CY83 3.85e-165 471 62 4 383 3 metK S-adenosylmethionine synthase Myxococcus xanthus (strain DK1622)
B1W470 6.11e-165 470 59 5 402 3 metK S-adenosylmethionine synthase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q311V1 1.59e-164 469 60 3 380 3 metK S-adenosylmethionine synthase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q827Q0 2.95e-164 469 58 5 402 3 metK S-adenosylmethionine synthase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A6LNU4 3.03e-164 468 57 4 390 3 metK S-adenosylmethionine synthase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
C0ZZD4 3.49e-164 468 60 4 399 3 metK S-adenosylmethionine synthase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q48SU7 6.56e-164 468 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M28 (strain MGAS6180)
A1VBJ1 9.16e-164 467 61 3 382 3 metK S-adenosylmethionine synthase Nitratidesulfovibrio vulgaris (strain DP4)
Q729A3 9.16e-164 467 61 3 382 1 metK S-adenosylmethionine synthase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q47R14 1.08e-163 467 60 5 396 3 metK S-adenosylmethionine synthase Thermobifida fusca (strain YX)
Q5XBJ6 1.35e-163 467 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
B7KFF5 1.53e-163 467 58 6 405 3 metK S-adenosylmethionine synthase Gloeothece citriformis (strain PCC 7424)
Q84FD3 1.56e-163 466 62 4 383 3 metK S-adenosylmethionine synthase Myxococcus xanthus
Q03AU4 1.94e-163 466 59 6 387 3 metK S-adenosylmethionine synthase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WCC9 1.94e-163 466 59 6 387 3 metK S-adenosylmethionine synthase Lacticaseibacillus casei (strain BL23)
B5XM14 2.23e-163 466 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M49 (strain NZ131)
A2RE06 2.23e-163 466 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JL80 2.23e-163 466 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JB36 2.23e-163 466 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q8P0G6 2.23e-163 466 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q97F85 3.92e-163 465 60 3 386 3 metK S-adenosylmethionine synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q1J626 4.02e-163 466 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q5M434 5.05e-163 465 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
P0DF55 6.09e-163 465 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DF54 6.09e-163 465 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q03GG8 6.62e-163 465 62 4 388 3 metK S-adenosylmethionine synthase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A0Q2Y4 6.84e-163 464 59 3 387 3 metK S-adenosylmethionine synthase Clostridium novyi (strain NT)
Q6MPK2 8.81e-163 464 61 1 382 3 metK S-adenosylmethionine synthase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q1JGA1 1.19e-162 464 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q99Z77 1.35e-162 464 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M1
C1FQQ5 2.27e-162 463 60 3 386 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Kyoto / Type A2)
B1KST9 2.38e-162 463 60 3 386 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Loch Maree / Type A3)
Q5LZI0 3e-162 463 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus thermophilus (strain CNRZ 1066)
C0M9M7 3.41e-162 463 60 3 388 3 metK S-adenosylmethionine synthase Streptococcus equi subsp. equi (strain 4047)
A5HY62 4.24e-162 462 60 3 386 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FQI8 4.24e-162 462 60 3 386 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain ATCC 19397 / Type A)
B4U228 5.57e-162 462 59 3 388 3 metK S-adenosylmethionine synthase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0MCM1 6.42e-162 462 59 3 388 3 metK S-adenosylmethionine synthase Streptococcus equi subsp. zooepidemicus (strain H70)
A7G9S1 7.09e-162 462 60 3 386 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IE45 1.15e-161 461 60 3 386 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Okra / Type B1)
Q1J1P4 1.48e-161 462 57 3 398 3 metK S-adenosylmethionine synthase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q30PN0 2.34e-161 461 57 2 381 3 metK S-adenosylmethionine synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q73JR4 2.89e-161 461 61 2 382 3 metK S-adenosylmethionine synthase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q0S0L4 8.15e-161 460 59 3 399 3 metK S-adenosylmethionine synthase Rhodococcus jostii (strain RHA1)
Q938W7 8.29e-161 460 57 5 407 3 metK S-adenosylmethionine synthase Streptomyces fradiae
B2TK10 8.37e-161 459 59 3 387 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Eklund 17B / Type B)
C1B4J7 9.29e-161 460 59 3 399 3 metK S-adenosylmethionine synthase Rhodococcus opacus (strain B4)
Q8DK88 1.81e-160 459 56 6 407 3 metK S-adenosylmethionine synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A5CRX0 1.91e-160 459 59 3 398 3 metK S-adenosylmethionine synthase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
A6QBY6 1.92e-160 458 58 3 383 3 metK S-adenosylmethionine synthase Sulfurovum sp. (strain NBC37-1)
C1CY25 3.02e-160 458 57 4 398 3 metK S-adenosylmethionine synthase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q3ZZN7 4.59e-160 458 55 3 388 3 metK S-adenosylmethionine synthase Dehalococcoides mccartyi (strain CBDB1)
B0REV4 5.81e-160 457 59 4 398 3 metK S-adenosylmethionine synthase Clavibacter sepedonicus
B2UZL0 7.28e-160 457 59 3 387 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Alaska E43 / Type E3)
Q5YTN0 1.04e-159 457 58 4 399 3 metK S-adenosylmethionine synthase Nocardia farcinica (strain IFM 10152)
A4SF76 1.17e-159 457 60 6 398 3 metK S-adenosylmethionine synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q9X4Q2 1.32e-159 457 58 5 394 3 metK S-adenosylmethionine synthase Streptomyces spectabilis
B7JX26 1.46e-159 457 57 6 406 3 metK S-adenosylmethionine synthase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q10VU5 1.79e-159 457 54 5 406 3 metK S-adenosylmethionine synthase Trichodesmium erythraeum (strain IMS101)
A5FRV2 2.39e-159 456 55 3 388 3 metK S-adenosylmethionine synthase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
A8LE19 3.6e-159 456 59 5 395 3 metK S-adenosylmethionine synthase Parafrankia sp. (strain EAN1pec)
Q3Z943 4.92e-159 456 54 3 388 3 metK S-adenosylmethionine synthase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
B8DSC3 8.66e-159 454 59 1 382 3 metK S-adenosylmethionine synthase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A8F5B8 1e-158 454 55 4 393 3 metK S-adenosylmethionine synthase Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q8CXS7 1.03e-158 454 61 4 380 3 metK S-adenosylmethionine synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72SM5 1.03e-158 454 61 4 380 3 metK S-adenosylmethionine synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B8HWM0 1.38e-158 455 55 5 406 3 metK S-adenosylmethionine synthase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q2J843 2.84e-158 453 58 4 395 3 metK2 S-adenosylmethionine synthase 2 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
A4X626 5.36e-158 452 58 5 400 3 metK S-adenosylmethionine synthase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
C0QXK7 7.29e-158 452 58 2 382 3 metK S-adenosylmethionine synthase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
B3QMF6 9.55e-158 452 59 6 401 3 metK S-adenosylmethionine synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A8LY25 2.58e-157 451 58 5 400 3 metK S-adenosylmethionine synthase Salinispora arenicola (strain CNS-205)
B3EDY2 3.28e-157 451 59 6 400 3 metK S-adenosylmethionine synthase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
B1XPB0 5.2e-157 451 55 6 405 3 metK S-adenosylmethionine synthase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q7U4S6 5.63e-157 451 56 9 408 3 metK S-adenosylmethionine synthase Parasynechococcus marenigrum (strain WH8102)
B0S2I6 1.03e-156 449 54 2 390 3 metK S-adenosylmethionine synthase Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
A5GJ24 1.06e-156 450 56 8 408 3 metK S-adenosylmethionine synthase Synechococcus sp. (strain WH7803)
B2IUI4 1.75e-156 450 55 5 407 3 metK S-adenosylmethionine synthase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q9RWM6 1.92e-156 449 55 3 398 3 metK S-adenosylmethionine synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q050E4 2.1e-156 448 60 4 380 3 metK S-adenosylmethionine synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04SB8 2.1e-156 448 60 4 380 3 metK S-adenosylmethionine synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B1VDN7 5.17e-156 447 57 4 399 3 metK S-adenosylmethionine synthase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q7VDM7 1.14e-155 447 55 9 408 3 metK S-adenosylmethionine synthase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
C5CD66 1.33e-155 446 55 2 394 3 metK S-adenosylmethionine synthase Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
A9BDW6 1.37e-155 447 56 9 405 3 metK S-adenosylmethionine synthase Prochlorococcus marinus (strain MIT 9211)
B1WZM0 2.08e-155 447 56 6 406 3 metK S-adenosylmethionine synthase Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q31KC6 2.83e-155 446 55 6 407 3 metK S-adenosylmethionine synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q0ICR7 5.28e-155 446 55 8 408 3 metK S-adenosylmethionine synthase Synechococcus sp. (strain CC9311)
Q8KEG7 7.71e-155 445 59 7 401 3 metK S-adenosylmethionine synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q3B531 8.79e-155 444 59 6 398 3 metK S-adenosylmethionine synthase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q7WYN1 1e-154 444 58 6 394 3 metK S-adenosylmethionine synthase Mycolicibacterium smegmatis
A0QWT3 1e-154 444 58 6 394 1 metK S-adenosylmethionine synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q6AF79 2.17e-154 443 57 3 392 3 metK S-adenosylmethionine synthase Leifsonia xyli subsp. xyli (strain CTCB07)
Q3AME2 3.19e-154 443 55 9 409 3 metK S-adenosylmethionine synthase Synechococcus sp. (strain CC9605)
Q3AWE6 6.39e-154 442 55 9 408 3 metK S-adenosylmethionine synthase Synechococcus sp. (strain CC9902)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_05815
Feature type CDS
Gene metK
Product methionine adenosyltransferase
Location 161413 - 162567 (strand: 1)
Length 1155 (nucleotides) / 384 (amino acids)

Contig

Accession ZDB_215
Length 284267 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_880
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00438 S-adenosylmethionine synthetase, N-terminal domain
PF02772 S-adenosylmethionine synthetase, central domain
PF02773 S-adenosylmethionine synthetase, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0192 Coenzyme transport and metabolism (H) H S-adenosylmethionine synthetase

Kegg Ortholog Annotation(s)

Protein Sequence

MTTHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTRAWVDIEEITRRTVREIGYTSSSMGFDADSCAVISAIGKQSADINQGVDRADPLEQGAGDQGLMFGYASNETDVLMPAPITYAHRLVERQAQVRKSGTLPWLRPDAKSQITFRYDDNKIAGIDAVVLSTQHSEDISQKDLHEAVMEEIIKPVLPVEWLDPTTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTGKVSNQQLTLLVREFFDLRPYGLIQMLDLLHPIYQETAAYGHFGRPQFPWEKTDKAEQLREAAGLK

Flanking regions ( +/- flanking 50bp)

ACATCCATCAATGTACCGAAAGTTCACTTCACTTAAGGTAGAGAAAAATAATGACTACACATCTTTTCACTTCTGAGTCCGTATCTGAAGGACACCCGGATAAAATTGCCGACCAAATTTCGGATGCAGTCCTTGATGCGATTTTAGAACAAGATCCCAAAGCGCGTGTTGCCTGCGAAACCTATGTCAAAACCGGTATGGTTCTGGTCGGCGGTGAAATCACCACCAGGGCATGGGTTGATATTGAGGAAATCACGCGCCGTACTGTCCGTGAGATTGGCTATACCAGCTCATCCATGGGCTTCGATGCTGATTCCTGTGCGGTAATCAGTGCTATCGGCAAACAATCTGCCGACATCAACCAGGGCGTTGACCGCGCTGACCCGCTTGAGCAGGGTGCCGGTGACCAGGGTCTGATGTTTGGTTATGCCTCAAACGAAACTGACGTGCTGATGCCGGCACCAATCACCTATGCTCACCGTCTGGTCGAGCGTCAGGCTCAGGTGCGTAAAAGCGGTACGCTGCCGTGGCTGCGTCCGGATGCGAAAAGCCAGATCACCTTCCGTTACGATGACAACAAAATCGCCGGGATTGATGCGGTTGTGCTGTCAACCCAGCACTCTGAAGATATCTCACAGAAAGATCTGCATGAAGCGGTGATGGAAGAGATCATCAAACCGGTTCTGCCGGTTGAGTGGCTGGATCCGACCACCAAATATTTCATCAACCCGACCGGCCGTTTTGTTATCGGCGGACCAATGGGTGACTGCGGTCTGACCGGCCGTAAAATCATCGTCGATACCTACGGCGGCATGGCACGTCACGGCGGCGGCGCATTCTCCGGTAAGGATCCGTCAAAAGTTGACCGTTCCGCAGCCTATGCGGCCCGTTATGTGGCAAAAAATATTGTCGCTGCCGGTCTTGCTGACCGCTGTGAAATCCAGGTCTCTTACGCGATTGGCGTGGCAGAGCCGACGTCCATTATGGTGGAAACCTTCGGTACCGGTAAAGTCTCCAACCAGCAACTGACGCTGCTGGTGCGCGAGTTCTTCGACCTGCGTCCGTACGGTCTGATTCAGATGCTGGATCTGCTGCACCCGATTTATCAGGAAACCGCAGCATACGGTCACTTCGGGCGTCCTCAGTTCCCGTGGGAAAAAACCGACAAAGCAGAGCAGCTGCGCGAAGCCGCTGGTCTGAAATAATTCCCTGTTATATTAACAGGCACAAAAAACCGGCTTTTCAGCCGGTTTTT