Homologs in group_229

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00975 FBDBKF_00975 76.5 Morganella morganii S1 cysM cysteine synthase CysM
EHELCC_00570 EHELCC_00570 76.5 Morganella morganii S2 cysM cysteine synthase CysM
NLDBIP_02890 NLDBIP_02890 76.5 Morganella morganii S4 cysM cysteine synthase CysM
LHKJJB_04405 LHKJJB_04405 76.5 Morganella morganii S3 cysM cysteine synthase CysM
HKOGLL_02640 HKOGLL_02640 76.5 Morganella morganii S5 cysM cysteine synthase CysM
F4V73_RS07050 F4V73_RS07050 76.5 Morganella psychrotolerans cysM cysteine synthase CysM
PMI_RS01140 PMI_RS01140 35.6 Proteus mirabilis HI4320 - cysteine synthase family protein

Distribution of the homologs in the orthogroup group_229

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_229

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P16703 9.13e-168 470 77 0 293 1 cysM Cysteine synthase B Escherichia coli (strain K12)
P29848 2.31e-166 466 76 0 293 1 cysM Cysteine synthase B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9I526 5.12e-144 409 70 0 285 3 cysM Cysteine synthase B Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P63872 2.97e-77 240 42 3 298 3 cysK Cysteine synthase Staphylococcus aureus (strain MW2)
Q6GBX5 2.97e-77 240 42 3 298 3 cysK Cysteine synthase Staphylococcus aureus (strain MSSA476)
Q6GJF8 2.97e-77 240 42 3 298 3 cysK Cysteine synthase Staphylococcus aureus (strain MRSA252)
P63871 2.97e-77 240 42 3 298 1 cysK Cysteine synthase Staphylococcus aureus (strain N315)
P63870 2.97e-77 240 42 3 298 3 cysK Cysteine synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HIG2 2.97e-77 240 42 3 298 3 cysK Cysteine synthase Staphylococcus aureus (strain COL)
P48028 7.83e-77 234 71 0 157 3 cysM Cysteine synthase B (Fragment) Pseudomonas syringae pv. syringae
Q8CMT6 1.17e-76 239 43 3 296 3 cysK Cysteine synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRP1 1.17e-76 239 43 3 296 3 cysK Cysteine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q00834 1.11e-74 234 47 4 298 1 None Cysteine synthase Spinacia oleracea
P31300 2.32e-72 230 46 4 291 2 None Cysteine synthase, chloroplastic/chromoplastic Capsicum annuum
O01592 2.57e-72 228 42 4 296 1 cysl-3 Cysteine synthase 3 Caenorhabditis elegans
O81155 4.17e-72 229 45 4 298 2 None Cysteine synthase, chloroplastic/chromoplastic Solanum tuberosum
O23733 1e-71 226 45 4 298 2 None Cysteine synthase Brassica juncea
Q43317 1.59e-71 226 47 4 298 1 None Cysteine synthase Citrullus lanatus
P32260 1.76e-70 225 44 4 300 1 CYSK Cysteine synthase, chloroplastic/chromoplastic Spinacia oleracea
Q7DDL5 2.22e-70 223 44 3 301 1 cysK Cysteine synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
O45679 2.44e-70 223 42 4 298 1 cysl-2 Bifunctional L-3-cyanoalanine synthase/cysteine synthase Caenorhabditis elegans
P47998 3.07e-70 223 45 4 298 1 OASA1 Cysteine synthase 1 Arabidopsis thaliana
P80608 3.46e-70 223 45 4 298 1 None Cysteine synthase Zea mays
O23735 8.9e-70 221 45 4 298 2 None Cysteine synthase Brassica juncea
Q9XEA6 1.08e-69 221 44 4 298 2 RCS1 Cysteine synthase Oryza sativa subsp. japonica
O32978 1.4e-69 221 42 3 298 3 cysK O-acetylserine sulfhydrylase Mycobacterium leprae (strain TN)
O67507 2.36e-69 221 45 5 297 3 cysM Cysteine synthase Aquifex aeolicus (strain VF5)
Q43153 3.95e-69 221 44 4 300 1 CYSC Bifunctional L-3-cyanoalanine synthase/cysteine synthase, mitochondrial Spinacia oleracea
O81154 5.06e-68 217 44 4 298 2 None Cysteine synthase Solanum tuberosum
P38076 6.08e-68 217 44 4 298 2 CYS1 Cysteine synthase Triticum aestivum
Q9XEA8 7.16e-68 217 45 4 297 2 RCS3 Cysteine synthase Oryza sativa subsp. japonica
Q5XAQ3 7.35e-68 216 42 4 298 1 cysK Cysteine synthase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
O22682 1.57e-67 218 43 4 291 1 CS26 S-sulfo-L-cysteine synthase (O-acetyl-L-serine-dependent), chloroplastic Arabidopsis thaliana
P9WP55 5.85e-67 214 42 3 300 1 cysK1 O-acetylserine sulfhydrylase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WP54 5.85e-67 214 42 3 300 3 cysK1 O-acetylserine sulfhydrylase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A535 5.85e-67 214 42 3 300 3 cysK O-acetylserine sulfhydrylase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q43725 3.64e-66 216 44 4 300 1 OASC Cysteine synthase, mitochondrial Arabidopsis thaliana
Q9S6Z7 8.24e-66 211 44 4 298 1 CYSD1 Bifunctional L-3-cyanoalanine synthase/cysteine synthase D1 Arabidopsis thaliana
Q93244 1.93e-65 211 41 4 297 1 cysl-1 Cysteine synthase 1 Caenorhabditis elegans
P73410 5.62e-65 209 46 5 304 3 cysK Cysteine synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P47999 3.65e-64 209 44 4 298 1 OASB Cysteine synthase, chloroplastic/chromoplastic Arabidopsis thaliana
Q76MX2 4.12e-64 208 42 5 300 1 PCAS-1 Bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial Solanum tuberosum
Q9FS29 5.1e-64 207 42 5 301 1 PCAS-2 Bifunctional L-3-cyanoalanine synthase/cysteine synthase 2, mitochondrial Solanum tuberosum
D2Z027 1.8e-63 205 41 4 294 1 dcsD O-ureido-L-serine synthase Streptomyces lavendulae
Q1KLZ1 4.06e-63 206 41 4 300 1 CAS2 L-3-cyanoalanine synthase 2, mitochondrial Malus domestica
Q1KLZ2 5.39e-63 206 41 4 300 1 CAS1 L-3-cyanoalanine synthase 1, mitochondrial Malus domestica
Q59447 4.93e-62 201 43 4 257 3 cysK Cysteine synthase Flavobacterium sp. (strain K3-15 / DSM ID92-509)
Q9S757 1.27e-61 202 41 4 297 1 CYSC1 Bifunctional L-3-cyanoalanine synthase/cysteine synthase C1, mitochondrial Arabidopsis thaliana
F4K5T2 4.09e-61 199 43 4 298 1 DES1 Bifunctional cystathionine gamma-lyase/cysteine synthase Arabidopsis thaliana
P37887 1.08e-60 198 42 3 298 1 cysK Cysteine synthase Bacillus subtilis (strain 168)
P0A1E3 3e-60 197 42 7 305 1 cysK Cysteine synthase A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1E4 3e-60 197 42 7 305 3 cysK Cysteine synthase A Salmonella typhi
O34476 4.46e-60 196 42 6 304 3 ytkP Probable cysteine synthase Bacillus subtilis (strain 168)
Q9SXS7 6.74e-60 196 42 4 300 1 CYSD2 Bifunctional L-3-cyanoalanine synthase/cysteine synthase D2 Arabidopsis thaliana
P0ABK5 1.15e-59 196 42 7 305 1 cysK Cysteine synthase A Escherichia coli (strain K12)
P0ABK6 1.15e-59 196 42 7 305 3 cysK Cysteine synthase A Escherichia coli O157:H7
Q59966 4.85e-59 194 44 4 305 2 srpG Cysteine synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P9WP53 1.13e-57 191 40 4 301 1 cysM O-phosphoserine sulfhydrylase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WP52 1.13e-57 191 40 4 301 3 cysM O-phosphoserine sulfhydrylase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63874 1.13e-57 191 40 4 301 3 cysM O-phosphoserine sulfhydrylase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P32232 7.76e-57 194 39 7 303 1 Cbs Cystathionine beta-synthase Rattus norvegicus
P71128 1.39e-56 187 37 5 298 3 cysM Cysteine synthase B Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q91WT9 3.58e-56 192 39 7 303 1 Cbs Cystathionine beta-synthase Mus musculus
P57171 6.39e-55 183 42 6 304 3 cysK Cysteine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P35520 2.88e-54 187 37 7 303 1 CBS Cystathionine beta-synthase Homo sapiens
P32582 2.45e-53 184 37 9 314 1 CYS4 Cystathionine beta-synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q58H57 6.28e-53 184 36 7 303 2 CBS Cystathionine beta-synthase Macaca fascicularis
P9WP51 1.55e-50 176 37 6 302 1 cbs Probable cystathionine beta-synthase Rv1077 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WP50 1.55e-50 176 37 6 302 3 cbs Putative cystathionine beta-synthase MT1108 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q2V0C9 7.59e-50 175 40 7 305 1 CBS Cystathionine beta-synthase Apis mellifera
Q9LJA0 7.72e-50 166 48 2 177 5 OASA2 Putative inactive cysteine synthase 2 Arabidopsis thaliana
O05393 1.92e-49 169 34 4 302 1 mccA O-acetylserine dependent cystathionine beta-synthase Bacillus subtilis (strain 168)
Q8KA48 6.39e-49 168 40 7 305 3 cysK Cysteine synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P45040 1.13e-48 167 39 6 303 1 cysK Cysteine synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9N0V7 1.34e-48 172 39 7 308 2 CBS Cystathionine beta-synthase Oryctolagus cuniculus
Q54CN7 1.65e-48 168 32 7 315 3 cysK Cysteine synthase Dictyostelium discoideum
P56067 6.19e-48 165 34 5 302 1 cysM Cysteine synthase Helicobacter pylori (strain ATCC 700392 / 26695)
Q5BD67 7.82e-48 168 35 8 338 3 cysF Cysteine synthase 2 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P46794 4.53e-47 167 36 5 307 2 cysB Cystathionine beta-synthase Dictyostelium discoideum
P87131 5.16e-47 165 32 7 325 3 cys12 Cysteine synthase 2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O59701 3.33e-46 162 33 7 316 1 cys11 Cysteine synthase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P50867 3.88e-46 162 35 8 309 3 cysB Cysteine synthase 1 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q9ZMW6 1.09e-42 151 34 5 305 3 cysM Cysteine synthase Helicobacter pylori (strain J99 / ATCC 700824)
Q44004 4.85e-42 150 33 5 300 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P53206 1e-41 151 33 8 328 1 MCY1 Putative mitochondrial cysteine synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q7RYW6 2.6e-40 147 36 9 313 3 cys-17 Cysteine synthase 1 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q7SHQ1 1.31e-39 147 35 10 328 3 cys-12 Cysteine synthase 2 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q8XSQ0 5.92e-37 137 33 6 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7A1Z6 2.14e-35 132 32 6 296 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain MW2)
A8YZ41 2.14e-35 132 32 6 296 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD09 2.14e-35 132 32 6 296 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain MSSA476)
Q6GKI9 2.14e-35 132 32 6 296 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain MRSA252)
Q932K9 2.14e-35 132 32 6 296 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QDA0 2.14e-35 132 32 6 296 1 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain Newman)
D0K799 2.14e-35 132 32 6 296 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain ED98)
Q5HJQ3 2.14e-35 132 32 6 296 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain COL)
A5INY7 2.14e-35 132 32 6 296 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain JH9)
Q2G1N3 2.14e-35 132 32 6 296 1 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
D2N3G7 2.14e-35 132 32 6 296 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain MRSA ST398 / isolate S0385)
D3ERF5 2.14e-35 132 32 6 296 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain 04-02981)
Q2FKE3 2.14e-35 132 32 6 296 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain USA300)
A6TXQ1 2.14e-35 132 32 6 296 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain JH1)
A7WX68 2.14e-35 132 32 6 296 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
D1GUM7 2.14e-35 132 32 6 296 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain TW20 / 0582)
Q99X99 2.79e-35 132 32 6 296 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain N315)
G5EFH8 2.84e-35 137 36 7 286 1 cbs-1 Cystathionine beta-synthase cbs-1 Caenorhabditis elegans
G5EFH8 4.9e-14 75 29 9 287 1 cbs-1 Cystathionine beta-synthase cbs-1 Caenorhabditis elegans
Q2YUU0 5.87e-35 131 32 7 299 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9N4K2 1.9e-33 132 34 9 308 2 cbs-2 Putative cystathionine beta-synthase cbs-2 Caenorhabditis elegans
Q9N4K2 1.71e-10 65 28 11 283 2 cbs-2 Putative cystathionine beta-synthase cbs-2 Caenorhabditis elegans
P55708 2.21e-31 122 29 7 304 3 NGR_a00730 Putative cysteine synthase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9YBL2 6.68e-22 97 30 11 290 1 cysO Protein CysO Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q59918 9.53e-21 89 33 3 149 3 cysK Cysteine synthase (Fragment) Staphylococcus haemolyticus
Q79FV4 2.03e-17 84 30 9 300 1 cysK2 S-sulfocysteine synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
O69652 8.2e-15 77 24 7 299 1 cds1 L-cysteine desulfhydrase Cds1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5U908 8.2e-15 77 24 7 299 1 cds1 L-cysteine desulfhydrase Cds1 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P09123 2.96e-13 72 28 11 301 3 thrC Threonine synthase Bacillus sp. (strain ULM1)
Q19374 1.86e-11 67 23 13 339 1 F13B12.4 Putative pyridoxal-phosphate dependent protein F13B12.4 Caenorhabditis elegans
P04990 8.79e-11 65 29 13 311 3 thrC Threonine synthase Bacillus subtilis (strain 168)
Q9K7E3 2.33e-08 58 33 4 137 3 thrC Threonine synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
C1FW07 2.35e-08 58 36 5 125 1 ortB 2-amino-4-ketopentanoate thiolase beta subunit Unknown prokaryotic organism
Q58860 8.01e-08 56 25 14 316 3 thrC Threonine synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P46493 1.78e-07 55 29 3 134 3 ilvA L-threonine dehydratase biosynthetic IlvA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8NWQ4 5.15e-07 53 33 3 112 3 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain MW2)
Q6G9C4 5.15e-07 53 33 3 112 3 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain MSSA476)
Q6GGX0 5.15e-07 53 33 3 112 3 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain MRSA252)
Q5HFY5 5.15e-07 53 33 3 112 3 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain COL)
Q2FYJ3 5.15e-07 53 33 3 112 3 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH01 5.15e-07 53 33 3 112 3 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain USA300)
P25306 5.18e-07 54 28 8 196 1 TD2 Threonine dehydratase 2 biosynthetic, chloroplastic Solanum lycopersicum
A0FKE6 7.15e-07 53 28 6 194 1 TD1 Threonine dehydratase 1 biosynthetic, chloroplastic Solanum lycopersicum
P45837 9.91e-07 53 34 4 127 3 thrC Threonine synthase Mycobacterium leprae (strain TN)
Q7A5L8 1.23e-06 52 33 3 112 1 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain N315)
Q99U50 1.23e-06 52 33 3 112 3 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain Mu50 / ATCC 700699)
A0R220 1.51e-06 52 33 4 127 1 thrC Threonine synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q2YY67 1.81e-06 52 33 3 112 3 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8TQD4 3.28e-06 51 28 10 222 1 thrC Threonine synthase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
O59791 5.38e-06 50 23 3 141 1 sry1 Serine racemase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P74193 5.71e-06 50 27 13 307 3 thrC Threonine synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A0JNI4 6.78e-06 50 25 6 202 2 SRR Serine racemase Bos taurus
Q9CKJ2 9.86e-06 50 28 3 134 3 ilvA L-threonine dehydratase biosynthetic IlvA Pasteurella multocida (strain Pm70)
Q8CNK9 1.11e-05 50 25 8 210 3 ilvA L-threonine dehydratase biosynthetic IlvA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HMF5 1.11e-05 50 25 8 210 3 ilvA L-threonine dehydratase biosynthetic IlvA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P9WG59 2.68e-05 48 33 4 127 1 thrC Threonine synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG58 2.68e-05 48 33 4 127 3 thrC Threonine synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P66903 2.68e-05 48 33 4 127 3 thrC Threonine synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P36007 3.89e-05 48 22 9 281 1 SRY1 L-threo-3-hydroxyaspartate ammonia-lyase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9CC54 5.91e-05 47 25 14 340 3 trpB Tryptophan synthase beta chain Mycobacterium leprae (strain TN)
Q10725 8.4e-05 47 25 6 202 1 psdht Phenylserine dehydratase Ralstonia pickettii
P20506 8.57e-05 47 33 2 102 3 ilvA L-Threonine dehydratase biosynthetic IlvA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P04968 0.000132 47 33 2 102 1 ilvA L-threonine dehydratase biosynthetic IlvA Escherichia coli (strain K12)
A0A6N3IN21 0.000154 46 29 2 140 1 Sdsl Serine dehydratase-like Rattus norvegicus
Q9GZT4 0.000213 45 22 4 193 1 SRR Serine racemase Homo sapiens
Q9ZSS6 0.000462 45 27 6 199 1 OMR1 Threonine dehydratase biosynthetic, chloroplastic Arabidopsis thaliana
Q39469 0.000532 45 25 7 200 2 None Threonine dehydratase biosynthetic, chloroplastic Cicer arietinum
Q74FW6 0.000586 44 26 4 141 1 tdcB L-threonine ammonia-lyase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q76EQ0 0.000606 44 29 4 141 1 Srr Serine racemase Rattus norvegicus
Q9AXU4 0.000724 44 25 7 194 1 TD Threonine dehydratase Nicotiana attenuata

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09035
Feature type CDS
Gene cysM
Product cysteine synthase CysM
Location 1968537 - 1969418 (strand: -1)
Length 882 (nucleotides) / 293 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_229
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00291 Pyridoxal-phosphate dependent enzyme

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0031 Amino acid transport and metabolism (E) E Cysteine synthase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12339 S-sulfo-L-cysteine synthase (O-acetyl-L-serine-dependent) [EC:2.5.1.144] Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of amino acids		 -

Protein Sequence

MAGLEQFIGNTPLVKLQRLSQGLDAEIWVKLEGNNPAGSVKDRAALSMIEQAELRGEIKPGDTLIEATSGNTGIALAMIAAVKGYRLKLLMPENMSKERQASMQAYGAELILVSREIGMEGARDLAQEMERKGEGKVLDQFNNPDNPRAHFTSTGPEIWQQTQGRITHFVSSMGTTGTITGVGSYLKTQSDTVKIVGLQPEEKSQIPGIRRWSPAYLPGIFRKELVDSVIDMSQTEAEQTMRLLASKEGIFCGVSSGGAVAGAIRVAKENPGAVIVAIICDRGDRYLSTGVFG

Flanking regions ( +/- flanking 50bp)

AAATATGATTTCTTCATTAATACAAACAAATAAATGATCAGGGATTTATTGTGGCAGGCTTAGAACAATTTATTGGTAATACACCATTGGTCAAATTACAACGACTTTCACAAGGATTAGATGCAGAAATATGGGTTAAGCTTGAAGGCAATAATCCGGCGGGTTCTGTGAAAGATAGAGCCGCGTTATCGATGATTGAGCAAGCTGAATTACGCGGTGAAATTAAACCTGGCGATACATTAATTGAGGCAACCAGTGGTAATACAGGGATTGCTTTAGCGATGATAGCGGCAGTAAAAGGTTATCGACTAAAATTATTAATGCCAGAAAATATGAGTAAAGAGCGTCAAGCATCCATGCAAGCGTATGGCGCCGAGCTTATTTTGGTTAGCCGCGAAATTGGTATGGAAGGGGCGAGAGATTTAGCGCAAGAAATGGAGCGTAAAGGTGAAGGCAAGGTATTAGATCAGTTTAATAACCCCGATAACCCTCGAGCGCATTTTACTTCAACTGGCCCTGAAATTTGGCAACAGACTCAAGGGCGTATTACCCATTTTGTTTCTAGCATGGGAACAACAGGTACGATAACTGGGGTGGGGAGTTACCTAAAAACACAATCGGACACAGTAAAAATTGTCGGTTTACAACCGGAAGAAAAAAGTCAAATTCCGGGTATTCGTCGTTGGTCTCCAGCCTATTTACCCGGTATTTTTCGAAAAGAGTTGGTTGATAGTGTTATAGATATGTCCCAAACAGAAGCAGAACAAACCATGCGCCTATTAGCGAGTAAAGAAGGTATATTCTGTGGCGTTAGTTCTGGGGGAGCCGTAGCTGGTGCAATACGCGTTGCTAAAGAGAACCCAGGGGCTGTGATTGTGGCGATTATTTGTGATAGAGGCGATCGCTATTTATCAACTGGGGTGTTTGGTTGAGTTTTCTGCGCTCGTTAAAGCTCATTCGCTTGCATATAAAAACCGCCACA