Homologs in group_1901

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14180 FBDBKF_14180 81.9 Morganella morganii S1 yfbR 5'-deoxynucleotidase
EHELCC_08100 EHELCC_08100 81.9 Morganella morganii S2 yfbR 5'-deoxynucleotidase
NLDBIP_08425 NLDBIP_08425 81.9 Morganella morganii S4 yfbR 5'-deoxynucleotidase
LHKJJB_05840 LHKJJB_05840 81.9 Morganella morganii S3 yfbR 5'-deoxynucleotidase
HKOGLL_05075 HKOGLL_05075 81.9 Morganella morganii S5 yfbR 5'-deoxynucleotidase
F4V73_RS02755 F4V73_RS02755 79.8 Morganella psychrotolerans yfbR 5'-deoxynucleotidase

Distribution of the homologs in the orthogroup group_1901

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1901

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8GLH5 1.02e-121 345 85 0 192 3 yfbR 5'-deoxynucleotidase yfbR Photorhabdus temperata
Q7N2I4 1.51e-121 344 84 0 192 3 plu3092 5'-deoxynucleotidase plu3092 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DA49 4.34e-118 335 83 0 192 3 PC1_2775 5'-deoxynucleotidase PC1_2775 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A1JLF1 1.07e-117 335 83 0 192 3 YE1340 5'-deoxynucleotidase YE1340 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JGL0 1.54e-117 334 83 0 192 3 YPK_1557 5'-deoxynucleotidase YPK_1557 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TM39 1.54e-117 334 83 0 192 3 YPDSF_1968 5'-deoxynucleotidase YPDSF_1968 Yersinia pestis (strain Pestoides F)
Q1CHP8 1.54e-117 334 83 0 192 3 YPN_2153 5'-deoxynucleotidase YPN_2153 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R6M4 1.54e-117 334 83 0 192 3 YpAngola_A1820 5'-deoxynucleotidase YpAngola_A1820 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDK3 1.54e-117 334 83 0 192 3 YPO2559 5'-deoxynucleotidase YPO2559 Yersinia pestis
B2K824 1.54e-117 334 83 0 192 3 YPTS_2685 5'-deoxynucleotidase YPTS_2685 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C6A6 1.54e-117 334 83 0 192 3 YPA_2050 5'-deoxynucleotidase YPA_2050 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FGQ0 1.54e-117 334 83 0 192 3 YpsIP31758_1449 5'-deoxynucleotidase YpsIP31758_1449 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6D2R1 8.67e-117 332 82 0 192 3 ECA3034 5'-deoxynucleotidase ECA3034 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q668Z7 1.05e-116 332 83 0 192 3 YPTB2590 5'-deoxynucleotidase YPTB2590 Yersinia pseudotuberculosis serotype I (strain IP32953)
A7MH33 1.04e-110 317 79 0 192 3 ESA_00928 5'-deoxynucleotidase ESA_00928 Cronobacter sakazakii (strain ATCC BAA-894)
B2VIV0 4.38e-110 315 78 0 192 3 ETA_12010 5'-deoxynucleotidase ETA_12010 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A6TBX7 2.77e-109 313 78 0 192 3 KPN78578_26370 5'-deoxynucleotidase KPN78578_26370 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNU9 2.77e-109 313 78 0 192 3 KPK_1466 5'-deoxynucleotidase KPK_1466 Klebsiella pneumoniae (strain 342)
Q32DP8 1.05e-108 312 78 0 192 3 yfbR 5'-deoxynucleotidase YfbR Shigella dysenteriae serotype 1 (strain Sd197)
Q1R9C4 2.15e-108 311 78 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain UTI89 / UPEC)
Q8FFJ5 2.15e-108 311 78 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFF5 2.15e-108 311 78 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ADE0 2.15e-108 311 78 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O1:K1 / APEC
B7MXX0 2.15e-108 311 78 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O81 (strain ED1a)
B7MG55 2.15e-108 311 78 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O45:K1 (strain S88 / ExPEC)
A4WCS0 2.2e-108 311 78 0 192 3 Ent638_2835 5'-deoxynucleotidase Ent638_2835 Enterobacter sp. (strain 638)
B7UFU9 3.12e-108 311 78 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A8ADU7 3.64e-108 310 77 0 192 3 CKO_00504 5'-deoxynucleotidase CKO_00504 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q83QS4 9.33e-108 310 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Shigella flexneri
Q0T2J6 9.33e-108 310 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Shigella flexneri serotype 5b (strain 8401)
B1LLP5 1.09e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain SMS-3-5 / SECEC)
B6I7L3 1.09e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain SE11)
B7N5Q3 1.09e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1IXQ1 1.09e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A2G0 1.09e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O9:H4 (strain HS)
B7M5X0 1.09e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O8 (strain IAI1)
B7NNX0 1.09e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YXT1 1.09e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCV3 1.09e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O157:H7
B7LBE5 1.09e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain 55989 / EAEC)
P76491 1.78e-107 309 77 0 192 1 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain K12)
B1X903 1.78e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain K12 / DH10B)
C4ZVI4 1.78e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain K12 / MC4100 / BW2952)
Q3YZR9 2.17e-107 308 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Shigella sonnei (strain Ss046)
B2TW72 1.54e-106 306 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A7ZPA5 1.54e-106 306 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8ZNE0 7.99e-106 305 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TQ66 7.99e-106 305 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella schwarzengrund (strain CVM19633)
B5BCL4 7.99e-106 305 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella paratyphi A (strain AKU_12601)
C0Q034 7.99e-106 305 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella paratyphi C (strain RKS4594)
A9N4B8 7.99e-106 305 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q3V7K9 7.99e-106 305 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SZ04 7.99e-106 305 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella newport (strain SL254)
B4TBJ9 7.99e-106 305 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella heidelberg (strain SL476)
B5RCF7 7.99e-106 305 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R313 7.99e-106 305 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella enteritidis PT4 (strain P125109)
B5FPH3 7.99e-106 305 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella dublin (strain CT_02021853)
Q57M23 7.99e-106 305 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella choleraesuis (strain SC-B67)
B5EZL4 7.99e-106 305 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella agona (strain SL483)
A9MJ94 3.08e-105 303 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8Z524 9.52e-105 302 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella typhi
Q7MMF9 3.18e-104 300 72 0 191 3 VV1113 5'-deoxynucleotidase VV1113 Vibrio vulnificus (strain YJ016)
Q6LNX0 1.22e-97 284 69 0 191 3 PBPRA2627 5'-deoxynucleotidase PBPRA2627 Photobacterium profundum (strain SS9)
Q87R72 1.48e-97 283 69 0 191 3 VP0926 5'-deoxynucleotidase VP0926 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KQM0 2.17e-96 281 68 0 191 3 VC_1978 5'-deoxynucleotidase VC_1978 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B7VHZ1 6.63e-96 279 67 0 191 3 VS_2195 5'-deoxynucleotidase VS_2195 Vibrio atlanticus (strain LGP32)
Q8EEA3 1.34e-77 233 55 0 193 3 SO_2484 5'-deoxynucleotidase SO_2484 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9CMR5 9.22e-74 223 57 0 192 3 PM0747 5'-deoxynucleotidase PM0747 Pasteurella multocida (strain Pm70)
Q8DG35 2.63e-56 178 63 0 133 3 VV1_0013 5'-deoxynucleotidase VV1_0013 Vibrio vulnificus (strain CMCP6)
A0A2L0V156 8.63e-09 56 37 1 78 1 datZ dATP triphosphohydrolase Salmonella phage PMBT28
G3FFN4 2.56e-05 46 39 3 73 3 datZ dATP triphosphohydrolase Vibrio phage phiVC8

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08660
Feature type CDS
Gene yfbR
Product 5'-deoxynucleotidase
Location 1892544 - 1893125 (strand: 1)
Length 582 (nucleotides) / 193 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1901
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF12917 5'-deoxynucleotidase YfbR-like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1896 Nucleotide transport and metabolism (F)
General function prediction only (R)		 FR 5'-deoxynucleotidase YfbR and related HD superfamily hydrolases

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08722 5'-deoxynucleotidase [EC:3.1.3.89] Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Nucleotide metabolism		 -

Protein Sequence

MSYFFAHLSRLKLITRWPLMRNIRQENVSEHSLQVAFVAHALAVIKNRKFDGNVNAERIALQAMYHDASEVITGDMPTPIKYHNPQIAHEYKKIEKYAQQKLIEMLPEELQEDFRPLIDEQLHSEEETFIVKQADSLCAYLKCLEELAAGNSEFNLAKNRLEKTLAERHSPEMDYFMQVFVPGFSLSLDEISE

Flanking regions ( +/- flanking 50bp)

GTGTCTATCCACTCACAATAATCTCTTCAATCACGCTATTGGGAGATATTATGAGTTACTTTTTTGCCCACCTTTCTCGTTTAAAGCTAATTACACGCTGGCCTCTGATGCGTAATATTCGCCAAGAAAATGTCTCTGAGCATAGTTTACAAGTGGCTTTTGTTGCCCATGCATTAGCGGTGATTAAAAATCGTAAATTTGATGGCAATGTCAACGCCGAGCGTATTGCACTACAAGCAATGTATCATGATGCCAGTGAGGTTATCACCGGTGATATGCCAACTCCTATTAAATACCACAATCCACAAATTGCTCATGAATATAAAAAAATAGAAAAATATGCTCAGCAAAAATTGATTGAAATGTTACCCGAAGAGTTACAAGAAGATTTTCGCCCTCTTATCGATGAGCAATTACATAGTGAGGAAGAAACGTTTATTGTCAAACAAGCTGATAGTTTATGTGCCTATTTAAAATGCCTTGAAGAGTTAGCTGCGGGTAATAGCGAATTTAATTTGGCCAAAAATCGTTTAGAAAAAACGTTAGCAGAAAGACATAGCCCTGAGATGGACTATTTTATGCAAGTGTTTGTACCAGGCTTTAGTTTATCCCTAGATGAGATCAGTGAATAAGTAGCAAAAACGCCGTTTAGCCGTTTATAATAAATGAAACTAAACGGCGT