Homologs in group_1901

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14180 FBDBKF_14180 94.3 Morganella morganii S1 yfbR 5'-deoxynucleotidase
EHELCC_08100 EHELCC_08100 94.3 Morganella morganii S2 yfbR 5'-deoxynucleotidase
NLDBIP_08425 NLDBIP_08425 94.3 Morganella morganii S4 yfbR 5'-deoxynucleotidase
LHKJJB_05840 LHKJJB_05840 94.3 Morganella morganii S3 yfbR 5'-deoxynucleotidase
HKOGLL_05075 HKOGLL_05075 94.3 Morganella morganii S5 yfbR 5'-deoxynucleotidase
PMI_RS08660 PMI_RS08660 79.8 Proteus mirabilis HI4320 yfbR 5'-deoxynucleotidase

Distribution of the homologs in the orthogroup group_1901

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1901

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8GLH5 2.91e-113 323 79 0 192 3 yfbR 5'-deoxynucleotidase yfbR Photorhabdus temperata
A1JLF1 1.11e-111 319 79 0 192 3 YE1340 5'-deoxynucleotidase YE1340 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DA49 2.51e-111 318 78 0 192 3 PC1_2775 5'-deoxynucleotidase PC1_2775 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q7N2I4 2.64e-111 318 77 0 192 3 plu3092 5'-deoxynucleotidase plu3092 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6D2R1 1.36e-110 317 78 0 192 3 ECA3034 5'-deoxynucleotidase ECA3034 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1JGL0 1.03e-109 314 78 0 192 3 YPK_1557 5'-deoxynucleotidase YPK_1557 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TM39 1.03e-109 314 78 0 192 3 YPDSF_1968 5'-deoxynucleotidase YPDSF_1968 Yersinia pestis (strain Pestoides F)
Q1CHP8 1.03e-109 314 78 0 192 3 YPN_2153 5'-deoxynucleotidase YPN_2153 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R6M4 1.03e-109 314 78 0 192 3 YpAngola_A1820 5'-deoxynucleotidase YpAngola_A1820 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDK3 1.03e-109 314 78 0 192 3 YPO2559 5'-deoxynucleotidase YPO2559 Yersinia pestis
B2K824 1.03e-109 314 78 0 192 3 YPTS_2685 5'-deoxynucleotidase YPTS_2685 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C6A6 1.03e-109 314 78 0 192 3 YPA_2050 5'-deoxynucleotidase YPA_2050 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FGQ0 1.03e-109 314 78 0 192 3 YpsIP31758_1449 5'-deoxynucleotidase YpsIP31758_1449 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2VIV0 2.27e-109 313 76 0 192 3 ETA_12010 5'-deoxynucleotidase ETA_12010 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q668Z7 5.74e-109 312 77 0 192 3 YPTB2590 5'-deoxynucleotidase YPTB2590 Yersinia pseudotuberculosis serotype I (strain IP32953)
A7MH33 5.77e-109 313 76 0 192 3 ESA_00928 5'-deoxynucleotidase ESA_00928 Cronobacter sakazakii (strain ATCC BAA-894)
Q1R9C4 1.46e-106 306 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain UTI89 / UPEC)
Q8FFJ5 1.46e-106 306 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFF5 1.46e-106 306 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ADE0 1.46e-106 306 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O1:K1 / APEC
B7MXX0 1.46e-106 306 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O81 (strain ED1a)
B7MG55 1.46e-106 306 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O45:K1 (strain S88 / ExPEC)
B2TW72 1.51e-106 306 74 0 192 3 yfbR 5'-deoxynucleotidase YfbR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A7ZPA5 1.51e-106 306 74 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O139:H28 (strain E24377A / ETEC)
B7UFU9 2.37e-106 306 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8ZNE0 4.78e-106 305 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TQ66 4.78e-106 305 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella schwarzengrund (strain CVM19633)
B5BCL4 4.78e-106 305 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella paratyphi A (strain AKU_12601)
C0Q034 4.78e-106 305 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella paratyphi C (strain RKS4594)
A9N4B8 4.78e-106 305 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q3V7K9 4.78e-106 305 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SZ04 4.78e-106 305 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella newport (strain SL254)
B4TBJ9 4.78e-106 305 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella heidelberg (strain SL476)
B5RCF7 4.78e-106 305 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R313 4.78e-106 305 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella enteritidis PT4 (strain P125109)
B5FPH3 4.78e-106 305 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella dublin (strain CT_02021853)
Q57M23 4.78e-106 305 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella choleraesuis (strain SC-B67)
B5EZL4 4.78e-106 305 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella agona (strain SL483)
Q3YZR9 6.71e-106 305 74 0 192 3 yfbR 5'-deoxynucleotidase YfbR Shigella sonnei (strain Ss046)
B1LLP5 8.26e-106 305 74 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain SMS-3-5 / SECEC)
B6I7L3 8.26e-106 305 74 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain SE11)
B7N5Q3 8.26e-106 305 74 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1IXQ1 8.26e-106 305 74 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A2G0 8.26e-106 305 74 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O9:H4 (strain HS)
B7M5X0 8.26e-106 305 74 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O8 (strain IAI1)
B7NNX0 8.26e-106 305 74 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YXT1 8.26e-106 305 74 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCV3 8.26e-106 305 74 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O157:H7
B7LBE5 8.26e-106 305 74 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain 55989 / EAEC)
Q83QS4 9.42e-106 305 74 0 192 3 yfbR 5'-deoxynucleotidase YfbR Shigella flexneri
Q0T2J6 9.42e-106 305 74 0 192 3 yfbR 5'-deoxynucleotidase YfbR Shigella flexneri serotype 5b (strain 8401)
P76491 1.65e-105 304 73 0 192 1 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain K12)
B1X903 1.65e-105 304 73 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain K12 / DH10B)
C4ZVI4 1.65e-105 304 73 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain K12 / MC4100 / BW2952)
Q8Z524 2.82e-105 303 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella typhi
A8ADU7 4.98e-105 303 73 0 192 3 CKO_00504 5'-deoxynucleotidase CKO_00504 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q32DP8 6.85e-105 302 73 0 192 3 yfbR 5'-deoxynucleotidase YfbR Shigella dysenteriae serotype 1 (strain Sd197)
A9MJ94 2.16e-104 301 75 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6TBX7 3.07e-104 301 73 0 192 3 KPN78578_26370 5'-deoxynucleotidase KPN78578_26370 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNU9 3.07e-104 301 73 0 192 3 KPK_1466 5'-deoxynucleotidase KPK_1466 Klebsiella pneumoniae (strain 342)
A4WCS0 2e-103 298 73 0 192 3 Ent638_2835 5'-deoxynucleotidase Ent638_2835 Enterobacter sp. (strain 638)
Q87R72 4e-102 295 71 0 191 3 VP0926 5'-deoxynucleotidase VP0926 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MMF9 8.78e-100 289 70 0 191 3 VV1113 5'-deoxynucleotidase VV1113 Vibrio vulnificus (strain YJ016)
Q6LNX0 1.52e-98 286 68 0 191 3 PBPRA2627 5'-deoxynucleotidase PBPRA2627 Photobacterium profundum (strain SS9)
B7VHZ1 2.22e-97 283 68 0 191 3 VS_2195 5'-deoxynucleotidase VS_2195 Vibrio atlanticus (strain LGP32)
Q9KQM0 2.53e-97 283 69 0 191 3 VC_1978 5'-deoxynucleotidase VC_1978 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8EEA3 1.7e-79 238 56 0 193 3 SO_2484 5'-deoxynucleotidase SO_2484 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9CMR5 3.2e-76 229 59 0 192 3 PM0747 5'-deoxynucleotidase PM0747 Pasteurella multocida (strain Pm70)
Q8DG35 2.02e-51 166 59 0 133 3 VV1_0013 5'-deoxynucleotidase VV1_0013 Vibrio vulnificus (strain CMCP6)
A0A2L0V156 1.41e-08 55 36 2 83 1 datZ dATP triphosphohydrolase Salmonella phage PMBT28

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS02755
Feature type CDS
Gene yfbR
Product 5'-deoxynucleotidase
Location 580320 - 580901 (strand: -1)
Length 582 (nucleotides) / 193 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1901
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF12917 5'-deoxynucleotidase YfbR-like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1896 Nucleotide transport and metabolism (F)
General function prediction only (R)		 FR 5'-deoxynucleotidase YfbR and related HD superfamily hydrolases

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08722 5'-deoxynucleotidase [EC:3.1.3.89] Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Nucleotide metabolism		 -

Protein Sequence

MSYFFAHLSRLKLITRWPLMRNVIAENVSEHSLQVAFVAHALAVIKNRKFGGSLNPEKIAMLAMYHDASEVITGDLPTPIKYYNPQIAHEYKKIERMAQKKLLAMIPEELQADFAPILDEDAHSEDDAAIVKQADALCAYLKCLEEIGAGNTEFNLAKARLEKTLEERSSPEMDYFREVFIPGFSLSLDEISQ

Flanking regions ( +/- flanking 50bp)

GCAAAATAACTAATATCACTTTTATCATGCTGCTGTCAGGAATGCTGTTTATGAGTTACTTTTTTGCCCACCTTTCACGTCTGAAACTAATCACCCGCTGGCCGCTGATGCGCAACGTAATCGCGGAAAATGTGTCAGAGCACAGCCTTCAGGTTGCGTTTGTCGCGCACGCACTTGCTGTGATTAAGAACCGAAAATTCGGTGGCTCGCTTAACCCGGAAAAAATTGCCATGCTGGCGATGTATCATGATGCCAGTGAAGTGATCACCGGCGACCTGCCGACACCGATTAAGTATTACAATCCGCAGATTGCACATGAATACAAAAAAATTGAGCGCATGGCGCAGAAAAAATTGCTGGCCATGATCCCGGAAGAATTACAGGCAGATTTTGCCCCGATCCTCGATGAAGATGCACATTCAGAAGACGATGCAGCGATTGTCAAACAGGCAGATGCCCTATGTGCGTACCTGAAATGTCTGGAAGAGATAGGTGCCGGTAATACCGAATTCAATCTGGCGAAAGCCCGGCTGGAAAAGACACTCGAAGAGCGCAGCAGCCCGGAAATGGACTATTTTCGCGAGGTATTTATCCCGGGATTCAGCCTGTCACTGGATGAGATAAGTCAGTAACCCGGAGTTCCCGAAATGAATGAAACAGATTTATTCAGGTTGCTTATCCG