Homologs in group_1901

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_08100 EHELCC_08100 100.0 Morganella morganii S2 yfbR 5'-deoxynucleotidase
NLDBIP_08425 NLDBIP_08425 100.0 Morganella morganii S4 yfbR 5'-deoxynucleotidase
LHKJJB_05840 LHKJJB_05840 100.0 Morganella morganii S3 yfbR 5'-deoxynucleotidase
HKOGLL_05075 HKOGLL_05075 100.0 Morganella morganii S5 yfbR 5'-deoxynucleotidase
F4V73_RS02755 F4V73_RS02755 94.3 Morganella psychrotolerans yfbR 5'-deoxynucleotidase
PMI_RS08660 PMI_RS08660 81.9 Proteus mirabilis HI4320 yfbR 5'-deoxynucleotidase

Distribution of the homologs in the orthogroup group_1901

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1901

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JLF1 2.95e-111 318 79 0 192 3 YE1340 5'-deoxynucleotidase YE1340 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DA49 5.59e-111 318 79 0 192 3 PC1_2775 5'-deoxynucleotidase PC1_2775 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q8GLH5 8.63e-111 317 78 0 192 3 yfbR 5'-deoxynucleotidase yfbR Photorhabdus temperata
Q6D2R1 2.08e-110 316 79 0 192 3 ECA3034 5'-deoxynucleotidase ECA3034 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2VIV0 3.4e-110 316 77 0 192 3 ETA_12010 5'-deoxynucleotidase ETA_12010 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B1JGL0 1.49e-109 314 79 0 192 3 YPK_1557 5'-deoxynucleotidase YPK_1557 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TM39 1.49e-109 314 79 0 192 3 YPDSF_1968 5'-deoxynucleotidase YPDSF_1968 Yersinia pestis (strain Pestoides F)
Q1CHP8 1.49e-109 314 79 0 192 3 YPN_2153 5'-deoxynucleotidase YPN_2153 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R6M4 1.49e-109 314 79 0 192 3 YpAngola_A1820 5'-deoxynucleotidase YpAngola_A1820 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDK3 1.49e-109 314 79 0 192 3 YPO2559 5'-deoxynucleotidase YPO2559 Yersinia pestis
B2K824 1.49e-109 314 79 0 192 3 YPTS_2685 5'-deoxynucleotidase YPTS_2685 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C6A6 1.49e-109 314 79 0 192 3 YPA_2050 5'-deoxynucleotidase YPA_2050 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FGQ0 1.49e-109 314 79 0 192 3 YpsIP31758_1449 5'-deoxynucleotidase YpsIP31758_1449 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7N2I4 2.73e-109 313 76 0 192 3 plu3092 5'-deoxynucleotidase plu3092 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q668Z7 7.23e-109 312 78 0 192 3 YPTB2590 5'-deoxynucleotidase YPTB2590 Yersinia pseudotuberculosis serotype I (strain IP32953)
B2TW72 1.97e-108 311 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A7ZPA5 1.97e-108 311 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O139:H28 (strain E24377A / ETEC)
Q1R9C4 2.56e-108 311 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain UTI89 / UPEC)
Q8FFJ5 2.56e-108 311 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFF5 2.56e-108 311 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ADE0 2.56e-108 311 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O1:K1 / APEC
B7MXX0 2.56e-108 311 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O81 (strain ED1a)
B7MG55 2.56e-108 311 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UFU9 3.33e-108 311 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3YZR9 8.18e-108 310 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Shigella sonnei (strain Ss046)
B1LLP5 1.06e-107 309 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain SMS-3-5 / SECEC)
B6I7L3 1.06e-107 309 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain SE11)
B7N5Q3 1.06e-107 309 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1IXQ1 1.06e-107 309 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A2G0 1.06e-107 309 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O9:H4 (strain HS)
B7M5X0 1.06e-107 309 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O8 (strain IAI1)
B7NNX0 1.06e-107 309 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YXT1 1.06e-107 309 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCV3 1.06e-107 309 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli O157:H7
B7LBE5 1.06e-107 309 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain 55989 / EAEC)
Q8Z524 1.23e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella typhi
Q83QS4 1.34e-107 309 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Shigella flexneri
Q0T2J6 1.34e-107 309 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Shigella flexneri serotype 5b (strain 8401)
Q8ZNE0 1.46e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TQ66 1.46e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella schwarzengrund (strain CVM19633)
B5BCL4 1.46e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella paratyphi A (strain AKU_12601)
C0Q034 1.46e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella paratyphi C (strain RKS4594)
A9N4B8 1.46e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q3V7K9 1.46e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SZ04 1.46e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella newport (strain SL254)
B4TBJ9 1.46e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella heidelberg (strain SL476)
B5RCF7 1.46e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R313 1.46e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella enteritidis PT4 (strain P125109)
B5FPH3 1.46e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella dublin (strain CT_02021853)
Q57M23 1.46e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella choleraesuis (strain SC-B67)
B5EZL4 1.46e-107 309 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella agona (strain SL483)
P76491 1.8e-107 309 76 0 192 1 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain K12)
B1X903 1.8e-107 309 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain K12 / DH10B)
C4ZVI4 1.8e-107 309 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Escherichia coli (strain K12 / MC4100 / BW2952)
A7MH33 1.92e-107 309 76 0 192 3 ESA_00928 5'-deoxynucleotidase ESA_00928 Cronobacter sakazakii (strain ATCC BAA-894)
A8ADU7 7.74e-107 307 76 0 192 3 CKO_00504 5'-deoxynucleotidase CKO_00504 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q32DP8 9.96e-107 307 76 0 192 3 yfbR 5'-deoxynucleotidase YfbR Shigella dysenteriae serotype 1 (strain Sd197)
A9MJ94 5.88e-106 305 77 0 192 3 yfbR 5'-deoxynucleotidase YfbR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6TBX7 7.99e-106 305 75 0 192 3 KPN78578_26370 5'-deoxynucleotidase KPN78578_26370 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNU9 7.99e-106 305 75 0 192 3 KPK_1466 5'-deoxynucleotidase KPK_1466 Klebsiella pneumoniae (strain 342)
A4WCS0 2.58e-105 303 75 0 192 3 Ent638_2835 5'-deoxynucleotidase Ent638_2835 Enterobacter sp. (strain 638)
Q87R72 3.43e-102 295 71 0 191 3 VP0926 5'-deoxynucleotidase VP0926 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MMF9 1.45e-99 288 69 0 191 3 VV1113 5'-deoxynucleotidase VV1113 Vibrio vulnificus (strain YJ016)
Q9KQM0 2.08e-97 283 69 0 191 3 VC_1978 5'-deoxynucleotidase VC_1978 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B7VHZ1 3.52e-97 283 68 0 191 3 VS_2195 5'-deoxynucleotidase VS_2195 Vibrio atlanticus (strain LGP32)
Q6LNX0 1.04e-96 281 67 0 191 3 PBPRA2627 5'-deoxynucleotidase PBPRA2627 Photobacterium profundum (strain SS9)
Q8EEA3 8.5e-81 241 58 0 193 3 SO_2484 5'-deoxynucleotidase SO_2484 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9CMR5 1.46e-75 228 58 0 192 3 PM0747 5'-deoxynucleotidase PM0747 Pasteurella multocida (strain Pm70)
Q8DG35 1.06e-51 167 58 0 133 3 VV1_0013 5'-deoxynucleotidase VV1_0013 Vibrio vulnificus (strain CMCP6)
A0A2L0V156 3.15e-08 54 36 2 83 1 datZ dATP triphosphohydrolase Salmonella phage PMBT28
Q66L17 0.001 42 28 6 146 2 hddc2 5'-deoxynucleotidase HDDC2 Xenopus laevis

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_14180
Feature type CDS
Gene yfbR
Product 5'-deoxynucleotidase
Location 33294 - 33875 (strand: 1)
Length 582 (nucleotides) / 193 (amino acids)

Contig

Accession contig_18
Length 100673 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1901
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF12917 5'-deoxynucleotidase YfbR-like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1896 Nucleotide transport and metabolism (F)
General function prediction only (R)
FR 5'-deoxynucleotidase YfbR and related HD superfamily hydrolases

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08722 5'-deoxynucleotidase [EC:3.1.3.89] Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Nucleotide metabolism
-

Protein Sequence

MSYFFAHLSRLKLITRWPLMRNVIQENVSEHSLQVAFVAHALAVIKNRKFGGTLNPEKIALLAMYHDASEVITGDLPTPIKYYNPQIAHEYKKIERMAQKKLIAMIPEELQADFAPLIDEDAHSPEDAAIVKQADALCAYLKCLEEIGAGNTEFHLAKARLEKTLEERRSPEMDYFRDVFIPGFSLSLDEISQ

Flanking regions ( +/- flanking 50bp)

GCAGAATATCCGCTCTTGTTATCAACAGATTGCTGCCAGGAATGTTGTCTATGAGTTACTTTTTTGCCCACCTTTCCCGTCTGAAACTGATCACCCGCTGGCCGCTGATGCGCAATGTGATTCAGGAAAACGTCTCTGAACACAGCCTTCAGGTGGCGTTTGTGGCACATGCACTGGCCGTGATTAAAAACCGCAAATTCGGCGGCACACTCAATCCGGAAAAAATTGCCCTGCTGGCGATGTACCATGATGCCAGTGAAGTGATTACCGGCGACCTGCCGACACCTATCAAGTATTACAATCCGCAGATAGCTCATGAGTACAAAAAAATTGAGCGCATGGCGCAAAAGAAACTGATTGCCATGATCCCTGAAGAGTTACAGGCGGATTTTGCTCCGCTGATTGATGAAGACGCGCATTCACCGGAAGATGCGGCAATCGTCAAACAGGCCGATGCCCTGTGTGCCTATCTCAAGTGTCTGGAAGAGATTGGTGCGGGTAATACCGAGTTTCATCTGGCGAAAGCGAGGCTGGAAAAAACCCTCGAAGAACGCCGCAGCCCGGAAATGGACTATTTCCGCGACGTGTTTATTCCGGGATTCAGTCTGTCACTGGATGAAATCAGCCAGTAACCGGGCAACTGCGTTTTCATCAGGGCACGCCGTCAGAACGGAAAAAGTAG