Homologs in group_1967

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14755 FBDBKF_14755 83.9 Morganella morganii S1 rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC
EHELCC_15560 EHELCC_15560 83.9 Morganella morganii S2 rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC
NLDBIP_16090 NLDBIP_16090 83.9 Morganella morganii S4 rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC
LHKJJB_15750 LHKJJB_15750 83.9 Morganella morganii S3 rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC
HKOGLL_14870 HKOGLL_14870 83.9 Morganella morganii S5 rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC
F4V73_RS07550 F4V73_RS07550 80.1 Morganella psychrotolerans rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC

Distribution of the homologs in the orthogroup group_1967

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1967

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZQ16 0.0 526 81 1 312 3 rluC Ribosomal large subunit pseudouridine synthase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AA40 0.0 525 81 1 312 3 rluC Ribosomal large subunit pseudouridine synthase C Shigella flexneri
P0AA39 0.0 525 81 1 312 1 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli (strain K12)
Q8X8J3 0.0 524 81 1 312 3 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli O157:H7
Q8FIP7 0.0 522 81 1 312 3 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8Z7J7 0.0 521 80 1 311 3 rluC Ribosomal large subunit pseudouridine synthase C Salmonella typhi
Q8ZFU1 0.0 518 81 1 318 3 rluC Ribosomal large subunit pseudouridine synthase C Yersinia pestis
Q9CM51 4.45e-170 478 72 1 317 3 rluC Ribosomal large subunit pseudouridine synthase C Pasteurella multocida (strain Pm70)
P44433 2.6e-166 468 71 0 310 3 rluC Ribosomal large subunit pseudouridine synthase C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P59835 2.09e-161 455 70 0 311 3 rluC Ribosomal large subunit pseudouridine synthase C Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q87N15 4.21e-144 411 66 2 309 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8D8G1 4.85e-144 411 65 2 312 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio vulnificus (strain CMCP6)
Q9KQH0 7.59e-140 400 62 2 310 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8K9J8 1.75e-123 359 55 3 308 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57430 1e-117 344 52 2 307 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9HZM9 5e-116 340 57 5 312 3 rluC Ribosomal large subunit pseudouridine synthase C Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q89AH2 8.17e-100 299 45 1 310 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q45480 1.81e-46 162 33 8 326 3 ylyB Uncharacterized RNA pseudouridine synthase YlyB Bacillus subtilis (strain 168)
Q82WZ5 1.65e-45 160 35 7 313 3 rluD Ribosomal large subunit pseudouridine synthase D Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q9JVB6 3.75e-39 144 35 10 317 3 rluD Ribosomal large subunit pseudouridine synthase D Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q45826 1.48e-38 141 32 10 322 3 Caur_0901 Uncharacterized RNA pseudouridine synthase Caur_0901 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q9K0B0 2.04e-38 142 35 10 317 3 rluD Ribosomal large subunit pseudouridine synthase D Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q8P682 1.22e-36 137 31 9 316 3 rluD Ribosomal large subunit pseudouridine synthase D Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9PET9 1.74e-35 134 32 8 325 3 rluD Ribosomal large subunit pseudouridine synthase D Xylella fastidiosa (strain 9a5c)
Q8PHN2 2.12e-35 133 31 8 318 3 rluD Ribosomal large subunit pseudouridine synthase D Xanthomonas axonopodis pv. citri (strain 306)
Q8XYX8 6.68e-35 133 30 7 310 3 rluD Ribosomal large subunit pseudouridine synthase D Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q68XB2 1.94e-34 130 31 8 293 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q87AR7 2.11e-34 131 32 9 325 3 rluD Ribosomal large subunit pseudouridine synthase D Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P75485 3.05e-34 130 34 8 295 3 MPN_292 Uncharacterized RNA pseudouridine synthase MG209 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
O50310 8.01e-34 129 31 9 320 3 Cpar_0723 Uncharacterized RNA pseudouridine synthase Cpar_0723 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q9ZDR7 1.22e-33 128 30 8 293 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia prowazekii (strain Madrid E)
P33640 1.37e-33 128 30 6 311 3 rluD Ribosomal large subunit pseudouridine synthase D Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P33643 1.56e-33 128 31 10 316 1 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli (strain K12)
P59838 1.68e-33 128 30 10 316 3 rluD Ribosomal large subunit pseudouridine synthase D Blochmanniella floridana
P65835 2.13e-33 128 31 10 316 3 rluD Ribosomal large subunit pseudouridine synthase D Shigella flexneri
P65834 2.13e-33 128 31 10 316 3 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X9F0 3.27e-33 127 31 10 316 3 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli O157:H7
Q8K9E9 3.64e-33 127 30 10 313 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q8ZBV7 3.73e-32 125 31 10 322 3 rluD Ribosomal large subunit pseudouridine synthase D Yersinia pestis
Q8DEV0 3.73e-32 125 30 8 315 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio vulnificus (strain CMCP6)
Q4UKQ3 4.25e-32 124 30 8 290 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P54604 4.72e-32 124 31 7 303 3 yhcT Uncharacterized RNA pseudouridine synthase YhcT Bacillus subtilis (strain 168)
P0AA38 4.96e-32 122 37 5 212 3 rluA Dual-specificity RNA pseudouridine synthase RluA Shigella flexneri
P0AA37 4.96e-32 122 37 5 212 1 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli (strain K12)
P74346 8.99e-32 124 31 11 327 3 slr1629 Uncharacterized RNA pseudouridine synthase slr1629 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8FL93 9.05e-32 121 37 5 212 3 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P65836 9.58e-32 124 31 10 316 1 rluD Ribosomal large subunit pseudouridine synthase D Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65837 9.58e-32 124 31 10 316 3 rluD Ribosomal large subunit pseudouridine synthase D Salmonella typhi
O67638 1.2e-31 123 31 9 318 3 aq_1758 Uncharacterized RNA pseudouridine synthase aq_1758 Aquifex aeolicus (strain VF5)
Q87S65 1.26e-31 123 31 7 315 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1RJX7 1.39e-31 122 29 7 299 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia bellii (strain RML369-C)
Q8ZRV9 4.49e-31 119 37 6 215 3 rluA Dual-specificity RNA pseudouridine synthase RluA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9CKA6 6.67e-31 121 31 9 310 3 rluD Ribosomal large subunit pseudouridine synthase D Pasteurella multocida (strain Pm70)
Q92IS6 8.43e-31 120 29 8 290 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q8XA10 1.03e-30 118 37 5 212 3 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli O157:H7
P50513 1.67e-30 120 29 9 320 3 rluD Ribosomal large subunit pseudouridine synthase D Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q8Z9J5 2e-30 117 36 6 215 3 rluA Dual-specificity RNA pseudouridine synthase RluA Salmonella typhi
P57481 3.66e-30 119 30 9 307 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O31613 9.36e-30 117 32 10 292 3 yjbO Uncharacterized RNA pseudouridine synthase YjbO Bacillus subtilis (strain 168)
P47451 4.09e-29 116 30 7 271 3 MG209 Uncharacterized RNA pseudouridine synthase MG209 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q89AD9 6.49e-29 116 29 9 297 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8X6T6 8.58e-29 114 34 4 229 3 truC tRNA pseudouridine synthase C Escherichia coli O157:H7
P0AA42 9.32e-29 114 34 4 229 3 truC tRNA pseudouridine synthase C Shigella flexneri
P0AA41 9.32e-29 114 34 4 229 1 truC tRNA pseudouridine synthase C Escherichia coli (strain K12)
P44445 1.07e-28 115 30 10 315 3 rluD Ribosomal large subunit pseudouridine synthase D Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44782 1.33e-28 112 35 4 210 3 rluA Dual-specificity RNA pseudouridine synthase RluA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8FEF9 2.08e-28 113 34 4 229 3 truC tRNA pseudouridine synthase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9KU20 2.16e-28 114 30 8 305 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9CK02 3.37e-28 111 35 4 208 3 rluA Dual-specificity RNA pseudouridine synthase RluA Pasteurella multocida (strain Pm70)
Q8ZIK1 6.4e-28 110 35 5 209 3 rluA Dual-specificity RNA pseudouridine synthase RluA Yersinia pestis
P59840 8.23e-28 111 35 7 244 3 truC tRNA pseudouridine synthase C Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q87LD3 9.34e-28 111 35 6 222 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P44197 1.78e-27 110 35 7 235 3 truC tRNA pseudouridine synthase C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A5T3 2.47e-27 111 31 10 308 3 BQ2027_MB1567 Uncharacterized RNA pseudouridine synthase Mb1567 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WHQ3 2.47e-27 111 31 10 308 1 Rv1540 Uncharacterized RNA pseudouridine synthase Rv1540 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHQ2 2.47e-27 111 31 10 308 3 MT1592 Uncharacterized RNA pseudouridine synthase MT1592 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8DCG0 2.78e-27 110 35 6 217 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio vulnificus (strain CMCP6)
P59831 8.22e-27 108 34 7 221 3 rluA Dual-specificity RNA pseudouridine synthase RluA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9KP71 1.47e-26 108 34 4 211 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9L7A7 6.12e-26 108 31 5 232 3 rluD Ribosomal large subunit pseudouridine synthase D Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q47417 1.78e-25 107 32 5 230 3 truC tRNA pseudouridine synthase C Pectobacterium carotovorum subsp. carotovorum
Q8ZMD5 3.24e-25 104 32 4 229 3 truC tRNA pseudouridine synthase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZH72 3.66e-25 104 34 6 223 3 truC tRNA pseudouridine synthase C Yersinia pestis
Q8Z439 3.9e-25 104 32 5 232 3 truC tRNA pseudouridine synthase C Salmonella typhi
Q9KTL4 1.12e-24 103 31 6 240 3 truC tRNA pseudouridine synthase C Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9CNF3 8.8e-24 100 34 6 223 3 truC tRNA pseudouridine synthase C Pasteurella multocida (strain Pm70)
Q8IZ73 1.42e-23 104 35 1 167 1 RPUSD2 Pseudouridylate synthase RPUSD2 Homo sapiens
Q9ZL98 1.59e-23 101 29 10 302 3 jhp_0682 Uncharacterized RNA pseudouridine synthase jhp_0682 Helicobacter pylori (strain J99 / ATCC 700824)
O66114 2.58e-23 99 34 8 229 3 ZMO0505 Uncharacterized RNA pseudouridine synthase ZMO0505 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q3ECD0 3.99e-23 102 26 12 374 2 At1g76050 RNA pseudouridine synthase 2, chloroplastic Arabidopsis thaliana
Q149F1 4.44e-23 102 35 1 167 1 Rpusd2 Pseudouridylate synthase RPUSD2 Mus musculus
Q87MD4 1.45e-22 97 30 6 233 3 truC tRNA pseudouridine synthase C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
O25441 1.5e-22 99 29 12 305 3 HP_0745 Uncharacterized RNA pseudouridine synthase HP_0745 Helicobacter pylori (strain ATCC 700392 / 26695)
P70870 2.32e-22 98 33 6 207 3 rluD Ribosomal large subunit pseudouridine synthase D Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q12069 4.44e-21 96 28 8 284 1 PUS9 tRNA pseudouridine(32) synthase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9LT72 9.55e-21 95 28 11 303 2 At3g19440 RNA pseudouridine synthase 4, mitochondrial Arabidopsis thaliana
P72970 1.35e-20 93 27 7 273 3 slr1592 Uncharacterized RNA pseudouridine synthase slr1592 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q0E0Y3 7.29e-20 92 28 6 284 2 Os02g0512300 RNA pseudouridine synthase 7 Oryza sativa subsp. japonica
Q8DBG5 7.68e-20 90 29 6 237 3 truC tRNA pseudouridine synthase C Vibrio vulnificus (strain CMCP6)
Q9LU60 9.45e-19 89 27 3 258 2 At5g51140 RNA pseudouridine synthase 7 Arabidopsis thaliana
Q28C59 1.08e-18 88 27 4 272 2 rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Xenopus tropicalis
Q09709 1.59e-18 88 30 7 229 3 SPAC18B11.02c Pseudouridylate synthase C18B11.02c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q4QQT0 8.67e-18 86 30 7 227 2 Rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Rattus norvegicus
Q96CM3 1.64e-17 85 29 7 228 1 RPUSD4 Pseudouridylate synthase RPUSD4, mitochondrial Homo sapiens
Q5E9Z1 1.65e-17 85 29 8 242 2 RPUSD4 Pseudouridylate synthase RPUSD4, mitochondrial Bos taurus
P45614 1.91e-17 84 25 8 262 3 MCAP_0714 Uncharacterized RNA pseudouridine synthase MCAP_0714 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q12362 3.02e-17 85 32 3 174 1 RIB2 Bifunctional protein RIB2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q5XET6 2.14e-16 82 28 9 254 2 At1g78910 RNA pseudouridine synthase 3, mitochondrial Arabidopsis thaliana
Q9CWX4 3.72e-16 81 30 7 227 2 Rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Mus musculus
Q5Z8P2 4.67e-16 81 28 5 187 2 Os06g0717400 RNA pseudouridine synthase 2, chloroplastic Oryza sativa subsp. japonica
Q9ZKP5 5.58e-16 79 29 7 196 3 jhp_0890 Uncharacterized RNA pseudouridine synthase jhp_0890 Helicobacter pylori (strain J99 / ATCC 700824)
O16686 6.02e-16 81 30 1 168 3 K07E8.7 Uncharacterized protein K07E8.7 Caenorhabditis elegans
P53294 2.11e-15 79 27 10 285 1 PUS6 tRNA pseudouridine(31) synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P47610 3.35e-15 78 25 10 293 3 MG370 Uncharacterized RNA pseudouridine synthase MG370 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q0DST9 4.05e-15 78 26 8 273 2 Os03g0288500 RNA pseudouridine synthase 5 Oryza sativa subsp. japonica
O25610 5.54e-15 76 29 7 214 3 HP_0956 Uncharacterized RNA pseudouridine synthase HP_0956 Helicobacter pylori (strain ATCC 700392 / 26695)
Q6DBR0 3.79e-14 75 28 7 215 2 rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Danio rerio
Q69K07 1.17e-13 74 29 10 246 2 Os09g0103500 RNA pseudouridine synthase 4, mitochondrial Oryza sativa subsp. japonica
Q2QNM3 1.26e-13 73 27 7 256 2 Os12g0560500 RNA pseudouridine synthase 1 Oryza sativa subsp. japonica
Q0J4D4 1.58e-13 74 27 8 237 2 Os08g0520100 RNA pseudouridine synthase 3, mitochondrial Oryza sativa subsp. japonica
P75230 7.89e-13 71 25 11 295 3 MPN_548 Uncharacterized RNA pseudouridine synthase MG370 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q08C69 1.31e-12 70 31 6 173 2 rpusd1 RNA pseudouridylate synthase domain-containing protein 1 Danio rerio
Q9ZMA1 1.41e-12 70 33 6 171 3 jhp_0321 Uncharacterized RNA pseudouridine synthase jhp_0321 Helicobacter pylori (strain J99 / ATCC 700824)
Q17QT4 1.44e-12 70 32 6 180 2 RPUSD1 RNA pseudouridylate synthase domain-containing protein 1 Bos taurus
Q8VCZ8 2.38e-12 69 32 6 180 2 Rpusd1 RNA pseudouridylate synthase domain-containing protein 1 Mus musculus
Q7XA65 2.74e-12 69 28 9 254 2 At1g56345 RNA pseudouridine synthase 1 Arabidopsis thaliana
O25114 5.58e-12 68 34 6 171 1 HP_0347 Uncharacterized RNA pseudouridine synthase HP_0347 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9UJJ7 6.3e-12 68 31 6 178 1 RPUSD1 RNA pseudouridylate synthase domain-containing protein 1 Homo sapiens
P43930 8.54e-12 67 28 5 197 3 HI_0042 Uncharacterized RNA pseudouridine synthase HI_0042 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5M721 3.77e-11 66 30 5 198 2 At3g52260 RNA pseudouridine synthase 5 Arabidopsis thaliana
Q06244 3.58e-05 48 26 8 192 1 PUS5 21S rRNA pseudouridine(2819) synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A3BN26 4.32e-05 48 25 8 234 2 Os07g0660400 RNA pseudouridine synthase 6, chloroplastic Oryza sativa subsp. japonica
Q8I3Z1 5.74e-05 48 42 1 61 1 PFE0570w MATH and LRR domain-containing protein PFE0570w Plasmodium falciparum (isolate 3D7)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04185
Feature type CDS
Gene rluC
Product 23S rRNA pseudouridine(955/2504/2580) synthase RluC
Location 945239 - 946192 (strand: 1)
Length 954 (nucleotides) / 317 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1967
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00849 RNA pseudouridylate synthase
PF01479 S4 domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0564 Translation, ribosomal structure and biogenesis (J) J Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06179 23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24] - -

Protein Sequence

MKSFNQVQFVTIDGDEAGQRIDNFLLARLKGVPKSMIYRIIRKGEVRVNKGRIKPEYKLAAGDSIRIPPVRVAEKEEHAVSPKLEKVSALAECILYEDEHVMLINKPSGTAVHGGSGLSFGVIEGLRALRPEARFLELVHRLDRDTSGVLLIAKKRSALRSLHEQLRLKQMQKDYLALVRGQWQSHTKVVQAPLLKNILQSGERVVKVSSEGKPSETRFKVEERFEFATLVKASPVTGRTHQIRVHTLHAGHPIAFDDRYGDRDFDTQLASTKLNRLFLHASSLTFIHPSTGEKMRIEAPMDKTLRYCLQVLRNQKS

Flanking regions ( +/- flanking 50bp)

AATAATTTGTTTGTCATTTTTTATTTTAAGAGAGCTAAAAAATCGCCACTATGAAATCATTTAATCAAGTTCAGTTCGTCACCATTGATGGCGATGAAGCAGGCCAGCGTATTGATAATTTTTTACTGGCACGCTTAAAAGGTGTACCGAAAAGTATGATTTACCGAATTATCCGCAAAGGTGAAGTTCGGGTTAATAAAGGGCGCATTAAGCCTGAATATAAATTAGCTGCAGGGGATAGCATTCGTATTCCTCCTGTCCGGGTAGCAGAAAAAGAAGAACATGCGGTATCGCCTAAGTTAGAAAAAGTATCAGCACTTGCTGAGTGTATTTTATATGAAGATGAACATGTGATGCTGATTAATAAGCCATCAGGGACGGCAGTACATGGTGGTAGCGGACTCAGTTTTGGTGTGATTGAAGGTTTAAGGGCATTGCGCCCAGAAGCGAGATTTCTAGAATTAGTGCATCGCCTTGATAGAGATACCTCAGGGGTATTGTTGATTGCTAAAAAGCGCTCAGCCCTGCGTTCACTACACGAACAGCTAAGATTAAAACAGATGCAAAAAGATTATTTAGCCTTAGTACGTGGTCAATGGCAATCTCATACAAAAGTAGTACAAGCCCCTTTATTGAAAAATATCCTACAAAGTGGTGAGCGGGTGGTTAAAGTAAGTAGTGAAGGTAAACCATCAGAAACACGCTTTAAGGTAGAAGAGCGCTTTGAATTTGCGACCTTAGTTAAAGCAAGTCCTGTCACGGGACGAACTCATCAAATTCGTGTCCATACATTACATGCCGGCCATCCTATTGCTTTTGATGATCGCTATGGTGATCGTGATTTTGATACACAATTAGCTTCAACCAAGCTTAATCGTCTCTTTTTACATGCGAGTTCATTAACCTTTATTCATCCCTCAACAGGGGAAAAAATGCGTATTGAAGCGCCGATGGATAAAACGTTACGTTACTGTTTACAAGTATTACGCAATCAAAAATCTTAATACTACTGTTTTCAAACTAGCAAAGTGGGAGAAAATTTTTTCCCACTTTG