Homologs in group_2004

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14755 FBDBKF_14755 100.0 Morganella morganii S1 rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC
EHELCC_15560 EHELCC_15560 100.0 Morganella morganii S2 rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC
NLDBIP_16090 NLDBIP_16090 100.0 Morganella morganii S4 rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC
HKOGLL_14870 HKOGLL_14870 100.0 Morganella morganii S5 rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC
F4V73_RS07550 F4V73_RS07550 90.9 Morganella psychrotolerans rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC
PMI_RS04185 PMI_RS04185 83.9 Proteus mirabilis HI4320 rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC

Distribution of the homologs in the orthogroup group_2004

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2004

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZFU1 0.0 525 80 0 314 3 rluC Ribosomal large subunit pseudouridine synthase C Yersinia pestis
Q8Z7J7 0.0 508 76 1 318 3 rluC Ribosomal large subunit pseudouridine synthase C Salmonella typhi
Q8FIP7 0.0 506 76 1 317 3 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA40 0.0 506 76 1 317 3 rluC Ribosomal large subunit pseudouridine synthase C Shigella flexneri
P0AA39 0.0 506 76 1 317 1 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli (strain K12)
Q8ZQ16 0.0 505 76 1 317 3 rluC Ribosomal large subunit pseudouridine synthase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X8J3 1.05e-180 504 76 1 317 3 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli O157:H7
P44433 3.8e-168 473 70 0 313 3 rluC Ribosomal large subunit pseudouridine synthase C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CM51 1.67e-167 471 70 0 317 3 rluC Ribosomal large subunit pseudouridine synthase C Pasteurella multocida (strain Pm70)
P59835 2.12e-165 466 69 0 316 3 rluC Ribosomal large subunit pseudouridine synthase C Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q87N15 8.52e-143 408 64 2 308 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8D8G1 9.4e-143 408 65 3 310 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio vulnificus (strain CMCP6)
Q9KQH0 4.95e-138 396 61 2 309 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8K9J8 1.88e-118 346 51 3 315 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9HZM9 2.35e-113 333 56 5 309 3 rluC Ribosomal large subunit pseudouridine synthase C Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P57430 7.35e-112 330 49 2 307 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AH2 3.33e-98 295 43 1 311 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q45480 1.29e-42 152 32 7 317 3 ylyB Uncharacterized RNA pseudouridine synthase YlyB Bacillus subtilis (strain 168)
Q82WZ5 1.55e-42 152 34 7 320 3 rluD Ribosomal large subunit pseudouridine synthase D Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q8P682 3.63e-41 149 32 8 329 3 rluD Ribosomal large subunit pseudouridine synthase D Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9JVB6 6.48e-40 146 35 9 309 3 rluD Ribosomal large subunit pseudouridine synthase D Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9PET9 1.19e-38 142 34 8 317 3 rluD Ribosomal large subunit pseudouridine synthase D Xylella fastidiosa (strain 9a5c)
Q45826 1.38e-38 142 33 9 317 3 Caur_0901 Uncharacterized RNA pseudouridine synthase Caur_0901 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q9K0B0 2.24e-38 142 34 9 309 3 rluD Ribosomal large subunit pseudouridine synthase D Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q8PHN2 2.2e-37 139 31 8 329 3 rluD Ribosomal large subunit pseudouridine synthase D Xanthomonas axonopodis pv. citri (strain 306)
Q87AR7 2.83e-37 139 33 8 318 3 rluD Ribosomal large subunit pseudouridine synthase D Xylella fastidiosa (strain Temecula1 / ATCC 700964)
O50310 3.96e-36 135 31 8 330 3 Cpar_0723 Uncharacterized RNA pseudouridine synthase Cpar_0723 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q8ZBV7 1.15e-35 134 33 10 326 3 rluD Ribosomal large subunit pseudouridine synthase D Yersinia pestis
P59838 1.4e-35 134 30 8 320 3 rluD Ribosomal large subunit pseudouridine synthase D Blochmanniella floridana
Q8XYX8 3.53e-35 134 31 8 325 3 rluD Ribosomal large subunit pseudouridine synthase D Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q68XB2 7.51e-35 131 31 8 295 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q8DEV0 6.69e-34 129 32 8 314 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio vulnificus (strain CMCP6)
P57481 3.44e-33 127 30 8 312 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P65836 3.93e-33 127 30 11 327 1 rluD Ribosomal large subunit pseudouridine synthase D Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65837 3.93e-33 127 30 11 327 3 rluD Ribosomal large subunit pseudouridine synthase D Salmonella typhi
Q1RJX7 4.04e-33 127 29 6 307 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia bellii (strain RML369-C)
Q9ZDR7 4.09e-33 127 31 8 295 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia prowazekii (strain Madrid E)
Q4UKQ3 7.27e-33 126 30 6 291 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q87S65 9.52e-33 126 31 7 322 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q89AD9 1.78e-32 125 31 11 309 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P65835 4.91e-32 124 30 10 326 3 rluD Ribosomal large subunit pseudouridine synthase D Shigella flexneri
P65834 4.91e-32 124 30 10 326 3 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9CKA6 5.18e-32 124 31 9 311 3 rluD Ribosomal large subunit pseudouridine synthase D Pasteurella multocida (strain Pm70)
Q8X9F0 7.43e-32 124 30 10 326 3 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli O157:H7
P74346 7.5e-32 124 30 11 337 3 slr1629 Uncharacterized RNA pseudouridine synthase slr1629 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P33643 7.59e-32 124 30 10 326 1 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli (strain K12)
O31613 9.19e-32 122 33 9 284 3 yjbO Uncharacterized RNA pseudouridine synthase YjbO Bacillus subtilis (strain 168)
P54604 1.46e-31 122 30 8 310 3 yhcT Uncharacterized RNA pseudouridine synthase YhcT Bacillus subtilis (strain 168)
Q8K9E9 1.47e-31 123 30 10 314 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q92IS6 4.63e-31 121 30 8 295 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P44445 5.74e-31 122 31 10 316 3 rluD Ribosomal large subunit pseudouridine synthase D Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8FL93 4.09e-30 117 36 5 212 3 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA38 6.43e-30 116 36 5 212 3 rluA Dual-specificity RNA pseudouridine synthase RluA Shigella flexneri
P0AA37 6.43e-30 116 36 5 212 1 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli (strain K12)
Q9CK02 1.38e-29 115 37 4 208 3 rluA Dual-specificity RNA pseudouridine synthase RluA Pasteurella multocida (strain Pm70)
P59840 1.56e-29 115 35 5 233 3 truC tRNA pseudouridine synthase C Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P75485 1.81e-29 117 32 8 315 3 MPN_292 Uncharacterized RNA pseudouridine synthase MG209 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
O67638 2.92e-29 117 29 9 316 3 aq_1758 Uncharacterized RNA pseudouridine synthase aq_1758 Aquifex aeolicus (strain VF5)
P0A5T3 6.73e-29 115 30 8 307 3 BQ2027_MB1567 Uncharacterized RNA pseudouridine synthase Mb1567 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WHQ3 6.73e-29 115 30 8 307 1 Rv1540 Uncharacterized RNA pseudouridine synthase Rv1540 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHQ2 6.73e-29 115 30 8 307 3 MT1592 Uncharacterized RNA pseudouridine synthase MT1592 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P33640 7.03e-29 116 30 6 308 3 rluD Ribosomal large subunit pseudouridine synthase D Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P44782 7.87e-29 113 35 5 210 3 rluA Dual-specificity RNA pseudouridine synthase RluA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KU20 9.2e-29 115 30 9 318 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8XA10 1.07e-28 113 35 5 212 3 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli O157:H7
P44197 1.12e-28 113 34 6 230 3 truC tRNA pseudouridine synthase C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8X6T6 3.42e-28 112 32 4 230 3 truC tRNA pseudouridine synthase C Escherichia coli O157:H7
P0AA42 3.5e-28 112 32 4 230 3 truC tRNA pseudouridine synthase C Shigella flexneri
P0AA41 3.5e-28 112 32 4 230 1 truC tRNA pseudouridine synthase C Escherichia coli (strain K12)
P47451 6.85e-28 113 31 6 274 3 MG209 Uncharacterized RNA pseudouridine synthase MG209 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q8Z9J5 7.78e-28 110 35 7 214 3 rluA Dual-specificity RNA pseudouridine synthase RluA Salmonella typhi
Q8FEF9 8.9e-28 111 32 4 230 3 truC tRNA pseudouridine synthase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8ZH72 1.62e-27 110 35 6 223 3 truC tRNA pseudouridine synthase C Yersinia pestis
Q8ZIK1 3.1e-27 108 35 5 208 3 rluA Dual-specificity RNA pseudouridine synthase RluA Yersinia pestis
Q8ZRV9 3.76e-27 108 35 7 214 3 rluA Dual-specificity RNA pseudouridine synthase RluA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P50513 5.4e-27 110 28 8 314 3 rluD Ribosomal large subunit pseudouridine synthase D Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q8DCG0 8.62e-27 108 36 7 217 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio vulnificus (strain CMCP6)
Q9L7A7 1.25e-26 110 32 6 234 3 rluD Ribosomal large subunit pseudouridine synthase D Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9KP71 4.1e-26 107 35 4 210 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8ZMD5 6.21e-26 107 32 4 230 3 truC tRNA pseudouridine synthase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q87LD3 6.77e-26 106 33 5 221 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8Z439 7.71e-26 106 32 4 230 3 truC tRNA pseudouridine synthase C Salmonella typhi
Q47417 3.77e-25 107 30 5 238 3 truC tRNA pseudouridine synthase C Pectobacterium carotovorum subsp. carotovorum
Q9CNF3 5.77e-25 103 33 5 224 3 truC tRNA pseudouridine synthase C Pasteurella multocida (strain Pm70)
Q149F1 3.22e-24 106 28 5 255 1 Rpusd2 Pseudouridylate synthase RPUSD2 Mus musculus
Q8IZ73 5.15e-24 105 27 4 255 1 RPUSD2 Pseudouridylate synthase RPUSD2 Homo sapiens
P59831 6.08e-24 100 34 6 210 3 rluA Dual-specificity RNA pseudouridine synthase RluA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q3ECD0 1.73e-23 103 26 14 367 2 At1g76050 RNA pseudouridine synthase 2, chloroplastic Arabidopsis thaliana
Q9ZL98 1.88e-23 101 29 11 298 3 jhp_0682 Uncharacterized RNA pseudouridine synthase jhp_0682 Helicobacter pylori (strain J99 / ATCC 700824)
O25441 1.21e-22 99 29 12 300 3 HP_0745 Uncharacterized RNA pseudouridine synthase HP_0745 Helicobacter pylori (strain ATCC 700392 / 26695)
Q5Z8P2 3.47e-22 99 25 11 377 2 Os06g0717400 RNA pseudouridine synthase 2, chloroplastic Oryza sativa subsp. japonica
Q9KTL4 3.51e-22 96 30 6 237 3 truC tRNA pseudouridine synthase C Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P70870 4.4e-22 97 29 9 247 3 rluD Ribosomal large subunit pseudouridine synthase D Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q12069 1.28e-21 98 30 6 244 1 PUS9 tRNA pseudouridine(32) synthase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O66114 1.34e-21 94 34 8 222 3 ZMO0505 Uncharacterized RNA pseudouridine synthase ZMO0505 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q87MD4 1.46e-21 94 28 4 230 3 truC tRNA pseudouridine synthase C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9LT72 2.17e-20 94 28 11 307 2 At3g19440 RNA pseudouridine synthase 4, mitochondrial Arabidopsis thaliana
Q0E0Y3 5.47e-20 92 27 8 286 2 Os02g0512300 RNA pseudouridine synthase 7 Oryza sativa subsp. japonica
Q09709 2.76e-19 90 30 5 225 3 SPAC18B11.02c Pseudouridylate synthase C18B11.02c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q28C59 3.29e-19 89 28 9 301 2 rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Xenopus tropicalis
Q12362 1.33e-18 89 28 7 263 1 RIB2 Bifunctional protein RIB2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8DBG5 3.4e-17 82 28 5 222 3 truC tRNA pseudouridine synthase C Vibrio vulnificus (strain CMCP6)
P45614 4.11e-17 83 24 9 304 3 MCAP_0714 Uncharacterized RNA pseudouridine synthase MCAP_0714 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
O16686 5.2e-17 84 30 1 172 3 K07E8.7 Uncharacterized protein K07E8.7 Caenorhabditis elegans
Q96CM3 2.02e-16 82 28 7 264 1 RPUSD4 Pseudouridylate synthase RPUSD4, mitochondrial Homo sapiens
Q9LU60 2.1e-16 82 26 5 261 2 At5g51140 RNA pseudouridine synthase 7 Arabidopsis thaliana
Q5XET6 4.12e-16 82 29 9 243 2 At1g78910 RNA pseudouridine synthase 3, mitochondrial Arabidopsis thaliana
P72970 6.7e-16 80 25 6 275 3 slr1592 Uncharacterized RNA pseudouridine synthase slr1592 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q4QQT0 7.89e-16 80 28 4 197 2 Rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Rattus norvegicus
Q9ZMA1 1.26e-15 79 34 6 175 3 jhp_0321 Uncharacterized RNA pseudouridine synthase jhp_0321 Helicobacter pylori (strain J99 / ATCC 700824)
Q9ZKP5 2.53e-15 77 30 7 196 3 jhp_0890 Uncharacterized RNA pseudouridine synthase jhp_0890 Helicobacter pylori (strain J99 / ATCC 700824)
Q5E9Z1 2.56e-15 79 28 6 238 2 RPUSD4 Pseudouridylate synthase RPUSD4, mitochondrial Bos taurus
O25114 4.44e-15 77 35 6 175 1 HP_0347 Uncharacterized RNA pseudouridine synthase HP_0347 Helicobacter pylori (strain ATCC 700392 / 26695)
P47610 5.05e-15 77 25 8 301 3 MG370 Uncharacterized RNA pseudouridine synthase MG370 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P53294 1.62e-14 77 26 10 281 1 PUS6 tRNA pseudouridine(31) synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O25610 3.43e-14 74 30 6 196 3 HP_0956 Uncharacterized RNA pseudouridine synthase HP_0956 Helicobacter pylori (strain ATCC 700392 / 26695)
Q69K07 4.33e-14 75 30 10 243 2 Os09g0103500 RNA pseudouridine synthase 4, mitochondrial Oryza sativa subsp. japonica
Q0J4D4 4.4e-14 75 30 6 202 2 Os08g0520100 RNA pseudouridine synthase 3, mitochondrial Oryza sativa subsp. japonica
Q17QT4 4.43e-14 75 31 9 232 2 RPUSD1 RNA pseudouridylate synthase domain-containing protein 1 Bos taurus
Q9CWX4 7.84e-14 74 28 4 197 2 Rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Mus musculus
Q0DST9 1.68e-13 73 26 8 273 2 Os03g0288500 RNA pseudouridine synthase 5 Oryza sativa subsp. japonica
Q2QNM3 2.25e-13 73 28 10 257 2 Os12g0560500 RNA pseudouridine synthase 1 Oryza sativa subsp. japonica
P75230 3.75e-13 72 27 12 303 3 MPN_548 Uncharacterized RNA pseudouridine synthase MG370 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q8VCZ8 1.92e-12 70 29 5 189 2 Rpusd1 RNA pseudouridylate synthase domain-containing protein 1 Mus musculus
Q5M721 3.34e-12 70 31 5 198 2 At3g52260 RNA pseudouridine synthase 5 Arabidopsis thaliana
Q6DBR0 3.96e-12 69 26 5 201 2 rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Danio rerio
Q7XA65 8.9e-12 68 26 9 257 2 At1g56345 RNA pseudouridine synthase 1 Arabidopsis thaliana
P43930 1.18e-10 63 29 6 200 3 HI_0042 Uncharacterized RNA pseudouridine synthase HI_0042 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9UJJ7 2.22e-10 64 28 5 187 1 RPUSD1 RNA pseudouridylate synthase domain-containing protein 1 Homo sapiens
Q08C69 2.72e-10 63 27 8 223 2 rpusd1 RNA pseudouridylate synthase domain-containing protein 1 Danio rerio
Q8I3Z1 3.72e-06 52 38 1 70 1 PFE0570w MATH and LRR domain-containing protein PFE0570w Plasmodium falciparum (isolate 3D7)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_15750
Feature type CDS
Gene rluC
Product 23S rRNA pseudouridine(955/2504/2580) synthase RluC
Location 39277 - 40236 (strand: 1)
Length 960 (nucleotides) / 319 (amino acids)
In genomic island -

Contig

Accession ZDB_374
Length 116739 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2004
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00849 RNA pseudouridylate synthase
PF01479 S4 domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0564 Translation, ribosomal structure and biogenesis (J) J Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06179 23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24] - -

Protein Sequence

MKTDNQTVQFVVVSGDEAGQRIDNFLLARLKGVPKSMIYRIIRKGEVRVNKGRIKPEYKIADGDSIRIPPVRVAEKNDAPVSAKLDKVSALAECVLYEDDHILVINKQAGTAVHGGSGLSFGVIEAMRALRPEARFLELVHRLDRDTSGILLIAKKRSALRALHEQLRLKQMQKDYLALVRGQWQSSVKVVQAPLLKNILQSGERVVKVSPEGKPSETRFKVEERFEAATLVKASPVTGRTHQIRVHTLHAGHPIAFDNRYGDAQFDAQLKGTGLNRLFLHAAALAFTHPSTGEAMRLQAPLDEKLRHCLTVLRSKQAK

Flanking regions ( +/- flanking 50bp)

AAAATATACCGGTTTACGGAGCAACGGTTCAGAGGATAGCCCCCCGTTTCATGAAAACTGATAATCAGACAGTTCAATTTGTTGTTGTGTCCGGCGATGAAGCCGGCCAGCGTATTGATAATTTCCTGCTCGCGCGCCTTAAAGGAGTGCCGAAGAGCATGATTTACCGCATCATCCGTAAAGGTGAAGTGCGTGTCAATAAAGGCCGGATTAAGCCGGAATACAAAATCGCGGACGGGGACAGCATCCGTATCCCGCCGGTGCGTGTGGCTGAGAAAAACGATGCCCCGGTGTCGGCGAAACTGGATAAGGTTTCTGCACTCGCAGAGTGCGTATTGTATGAAGATGATCATATTCTGGTGATTAATAAACAGGCGGGTACGGCGGTACACGGCGGCAGTGGTCTGAGTTTCGGTGTGATTGAGGCGATGCGCGCACTGCGTCCGGAGGCGCGCTTCCTGGAACTGGTGCACCGGCTTGACCGCGATACTTCCGGTATTCTGCTGATCGCCAAAAAACGTTCCGCACTGCGGGCACTGCACGAGCAGCTGCGTCTGAAACAGATGCAGAAAGATTATCTGGCACTGGTGCGCGGCCAGTGGCAATCCTCAGTAAAAGTGGTACAGGCACCGCTGCTGAAAAATATTCTCCAGAGCGGCGAGCGCGTGGTGAAAGTCAGCCCGGAAGGCAAGCCATCGGAAACACGCTTTAAAGTGGAGGAGCGGTTTGAGGCTGCCACGCTGGTCAAAGCCAGTCCGGTCACCGGGCGCACACATCAGATTCGTGTGCACACACTGCATGCAGGGCATCCTATTGCCTTTGATAACCGTTACGGTGATGCGCAGTTTGATGCTCAGCTGAAAGGGACAGGGCTTAACCGGCTGTTTTTACATGCGGCGGCACTTGCCTTTACCCATCCGTCCACCGGCGAGGCGATGCGCCTTCAGGCACCGCTGGATGAAAAACTACGCCACTGCCTGACGGTACTGCGGTCGAAACAGGCAAAATAAGCAGAGAGCAGAAATAAAGAACCCGCGCAGAACGCGGGTTTTTTCTTATA