Homologs in group_2004

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14755 FBDBKF_14755 90.9 Morganella morganii S1 rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC
EHELCC_15560 EHELCC_15560 90.9 Morganella morganii S2 rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC
NLDBIP_16090 NLDBIP_16090 90.9 Morganella morganii S4 rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC
LHKJJB_15750 LHKJJB_15750 90.9 Morganella morganii S3 rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC
HKOGLL_14870 HKOGLL_14870 90.9 Morganella morganii S5 rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC
PMI_RS04185 PMI_RS04185 80.1 Proteus mirabilis HI4320 rluC 23S rRNA pseudouridine(955/2504/2580) synthase RluC

Distribution of the homologs in the orthogroup group_2004

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2004

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZFU1 0.0 522 80 0 314 3 rluC Ribosomal large subunit pseudouridine synthase C Yersinia pestis
Q8FIP7 0.0 506 77 1 316 3 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA40 0.0 505 77 1 316 3 rluC Ribosomal large subunit pseudouridine synthase C Shigella flexneri
Q8Z7J7 0.0 505 76 1 318 3 rluC Ribosomal large subunit pseudouridine synthase C Salmonella typhi
P0AA39 0.0 505 77 1 316 1 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli (strain K12)
Q8X8J3 0.0 505 77 1 316 3 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli O157:H7
Q8ZQ16 3.42e-180 503 76 1 316 3 rluC Ribosomal large subunit pseudouridine synthase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9CM51 5.16e-168 472 69 0 316 3 rluC Ribosomal large subunit pseudouridine synthase C Pasteurella multocida (strain Pm70)
P44433 1.37e-165 466 69 0 313 3 rluC Ribosomal large subunit pseudouridine synthase C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P59835 5.16e-163 459 69 0 316 3 rluC Ribosomal large subunit pseudouridine synthase C Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q87N15 7.27e-142 405 65 3 309 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8D8G1 1.84e-141 405 65 3 310 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio vulnificus (strain CMCP6)
Q9KQH0 1.12e-137 395 62 2 309 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8K9J8 1.89e-120 351 51 3 315 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9HZM9 4.67e-116 340 57 5 310 3 rluC Ribosomal large subunit pseudouridine synthase C Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P57430 7.44e-113 332 48 2 309 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AH2 5.64e-101 302 45 1 298 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q45480 2.1e-44 156 32 6 312 3 ylyB Uncharacterized RNA pseudouridine synthase YlyB Bacillus subtilis (strain 168)
Q9JVB6 6.67e-41 149 35 10 311 3 rluD Ribosomal large subunit pseudouridine synthase D Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q8P682 1.08e-40 147 33 8 315 3 rluD Ribosomal large subunit pseudouridine synthase D Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9K0B0 5.14e-40 147 35 10 311 3 rluD Ribosomal large subunit pseudouridine synthase D Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q82WZ5 2.47e-39 144 33 6 312 3 rluD Ribosomal large subunit pseudouridine synthase D Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q45826 2.55e-39 144 33 10 318 3 Caur_0901 Uncharacterized RNA pseudouridine synthase Caur_0901 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q9PET9 2.12e-38 141 33 8 315 3 rluD Ribosomal large subunit pseudouridine synthase D Xylella fastidiosa (strain 9a5c)
Q8PHN2 3e-38 141 32 8 315 3 rluD Ribosomal large subunit pseudouridine synthase D Xanthomonas axonopodis pv. citri (strain 306)
Q8XYX8 5.17e-38 141 32 8 324 3 rluD Ribosomal large subunit pseudouridine synthase D Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q87AR7 8.52e-37 137 33 8 315 3 rluD Ribosomal large subunit pseudouridine synthase D Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q1RJX7 5.05e-36 134 30 8 306 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia bellii (strain RML369-C)
Q68XB2 5.12e-36 134 32 7 293 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZDR7 6.7e-35 131 31 7 293 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia prowazekii (strain Madrid E)
Q8ZBV7 2.56e-34 130 32 9 323 3 rluD Ribosomal large subunit pseudouridine synthase D Yersinia pestis
O50310 7.98e-34 129 31 9 326 3 Cpar_0723 Uncharacterized RNA pseudouridine synthase Cpar_0723 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q4UKQ3 9e-34 129 29 7 300 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q87S65 1.42e-33 129 30 8 322 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P65836 3.54e-33 127 32 9 321 1 rluD Ribosomal large subunit pseudouridine synthase D Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65837 3.54e-33 127 32 9 321 3 rluD Ribosomal large subunit pseudouridine synthase D Salmonella typhi
P65835 3.58e-33 127 31 9 322 3 rluD Ribosomal large subunit pseudouridine synthase D Shigella flexneri
P65834 3.58e-33 127 31 9 322 3 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X9F0 5.77e-33 127 31 9 322 3 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli O157:H7
P33643 6.02e-33 127 31 9 322 1 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli (strain K12)
P59838 8.59e-33 126 30 9 323 3 rluD Ribosomal large subunit pseudouridine synthase D Blochmanniella floridana
Q89AD9 1.56e-32 125 32 10 298 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P57481 1.94e-32 125 30 8 297 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8DEV0 2.4e-32 125 31 8 319 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio vulnificus (strain CMCP6)
P74346 2.45e-32 125 31 12 323 3 slr1629 Uncharacterized RNA pseudouridine synthase slr1629 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9CKA6 2.86e-32 125 31 8 315 3 rluD Ribosomal large subunit pseudouridine synthase D Pasteurella multocida (strain Pm70)
P54604 7.98e-32 123 30 7 310 3 yhcT Uncharacterized RNA pseudouridine synthase YhcT Bacillus subtilis (strain 168)
Q92IS6 8.15e-32 123 29 7 300 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia conorii (strain ATCC VR-613 / Malish 7)
O67638 1.49e-31 123 32 10 292 3 aq_1758 Uncharacterized RNA pseudouridine synthase aq_1758 Aquifex aeolicus (strain VF5)
P44782 1.67e-31 120 37 4 210 3 rluA Dual-specificity RNA pseudouridine synthase RluA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CK02 1.86e-31 120 37 5 209 3 rluA Dual-specificity RNA pseudouridine synthase RluA Pasteurella multocida (strain Pm70)
Q8FL93 7.46e-31 119 36 4 210 3 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA38 1.22e-30 118 36 4 210 3 rluA Dual-specificity RNA pseudouridine synthase RluA Shigella flexneri
P0AA37 1.22e-30 118 36 4 210 1 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli (strain K12)
Q8K9E9 1.44e-30 120 29 9 311 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P47451 1.75e-30 120 30 6 276 3 MG209 Uncharacterized RNA pseudouridine synthase MG209 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P33640 1.76e-30 120 30 9 313 3 rluD Ribosomal large subunit pseudouridine synthase D Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A5T3 3.22e-30 119 31 8 312 3 BQ2027_MB1567 Uncharacterized RNA pseudouridine synthase Mb1567 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WHQ3 3.22e-30 119 31 8 312 1 Rv1540 Uncharacterized RNA pseudouridine synthase Rv1540 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHQ2 3.22e-30 119 31 8 312 3 MT1592 Uncharacterized RNA pseudouridine synthase MT1592 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O31613 5.88e-30 118 33 10 280 3 yjbO Uncharacterized RNA pseudouridine synthase YjbO Bacillus subtilis (strain 168)
P44445 8.43e-30 118 30 9 318 3 rluD Ribosomal large subunit pseudouridine synthase D Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P59840 1.19e-29 116 35 6 235 3 truC tRNA pseudouridine synthase C Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8XA10 1.67e-29 115 35 4 210 3 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli O157:H7
Q9KU20 2.02e-29 117 29 9 310 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P50513 3.03e-29 117 29 8 305 3 rluD Ribosomal large subunit pseudouridine synthase D Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
P75485 3.44e-29 116 32 9 312 3 MPN_292 Uncharacterized RNA pseudouridine synthase MG209 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q9KP71 1.53e-28 113 36 5 211 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8ZIK1 1.88e-28 112 35 5 208 3 rluA Dual-specificity RNA pseudouridine synthase RluA Yersinia pestis
Q8Z9J5 2.39e-28 112 35 4 210 3 rluA Dual-specificity RNA pseudouridine synthase RluA Salmonella typhi
Q8ZRV9 2.65e-28 112 35 4 210 3 rluA Dual-specificity RNA pseudouridine synthase RluA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8DCG0 3.9e-28 112 36 5 216 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio vulnificus (strain CMCP6)
Q87LD3 9.54e-28 111 35 8 225 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P44197 1.8e-27 110 33 6 230 3 truC tRNA pseudouridine synthase C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8ZH72 2.12e-27 110 35 6 222 3 truC tRNA pseudouridine synthase C Yersinia pestis
Q8X6T6 4.98e-27 109 31 4 230 3 truC tRNA pseudouridine synthase C Escherichia coli O157:H7
P0AA42 6.06e-27 109 31 4 230 3 truC tRNA pseudouridine synthase C Shigella flexneri
P0AA41 6.06e-27 109 31 4 230 1 truC tRNA pseudouridine synthase C Escherichia coli (strain K12)
Q8FEF9 1.32e-26 108 31 4 230 3 truC tRNA pseudouridine synthase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P59831 2.69e-26 107 35 6 206 3 rluA Dual-specificity RNA pseudouridine synthase RluA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9L7A7 3.67e-26 108 30 6 238 3 rluD Ribosomal large subunit pseudouridine synthase D Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9CNF3 6.93e-26 106 32 5 232 3 truC tRNA pseudouridine synthase C Pasteurella multocida (strain Pm70)
Q47417 2.28e-25 107 30 5 238 3 truC tRNA pseudouridine synthase C Pectobacterium carotovorum subsp. carotovorum
Q3ECD0 1.88e-24 105 26 13 381 2 At1g76050 RNA pseudouridine synthase 2, chloroplastic Arabidopsis thaliana
Q8ZMD5 2.21e-24 102 31 4 230 3 truC tRNA pseudouridine synthase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z439 3.17e-24 102 31 4 230 3 truC tRNA pseudouridine synthase C Salmonella typhi
Q9ZL98 5.72e-24 103 29 11 297 3 jhp_0682 Uncharacterized RNA pseudouridine synthase jhp_0682 Helicobacter pylori (strain J99 / ATCC 700824)
O25441 6.26e-24 102 30 13 310 3 HP_0745 Uncharacterized RNA pseudouridine synthase HP_0745 Helicobacter pylori (strain ATCC 700392 / 26695)
Q5Z8P2 4.37e-23 102 27 9 358 2 Os06g0717400 RNA pseudouridine synthase 2, chloroplastic Oryza sativa subsp. japonica
Q8IZ73 5.5e-23 102 33 1 167 1 RPUSD2 Pseudouridylate synthase RPUSD2 Homo sapiens
P70870 8.73e-23 99 31 9 224 3 rluD Ribosomal large subunit pseudouridine synthase D Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q149F1 1.54e-22 101 33 1 172 1 Rpusd2 Pseudouridylate synthase RPUSD2 Mus musculus
Q87MD4 3.89e-22 96 28 4 237 3 truC tRNA pseudouridine synthase C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9LT72 4.14e-22 99 34 10 226 2 At3g19440 RNA pseudouridine synthase 4, mitochondrial Arabidopsis thaliana
Q9KTL4 1.32e-21 94 29 5 225 3 truC tRNA pseudouridine synthase C Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O66114 1.41e-21 94 36 8 208 3 ZMO0505 Uncharacterized RNA pseudouridine synthase ZMO0505 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q12069 5.86e-21 96 35 4 174 1 PUS9 tRNA pseudouridine(32) synthase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P45614 1.5e-19 90 25 8 271 3 MCAP_0714 Uncharacterized RNA pseudouridine synthase MCAP_0714 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q09709 3.35e-19 90 32 2 172 3 SPAC18B11.02c Pseudouridylate synthase C18B11.02c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8DBG5 4.07e-19 88 29 6 225 3 truC tRNA pseudouridine synthase C Vibrio vulnificus (strain CMCP6)
Q0E0Y3 4.19e-19 90 27 7 284 2 Os02g0512300 RNA pseudouridine synthase 7 Oryza sativa subsp. japonica
Q12362 2.26e-18 89 31 5 203 1 RIB2 Bifunctional protein RIB2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P47610 8.36e-18 85 26 9 310 3 MG370 Uncharacterized RNA pseudouridine synthase MG370 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P53294 1.6e-17 85 27 11 290 1 PUS6 tRNA pseudouridine(31) synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9LU60 4e-17 84 27 8 258 2 At5g51140 RNA pseudouridine synthase 7 Arabidopsis thaliana
Q28C59 4.62e-17 83 29 10 301 2 rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Xenopus tropicalis
P72970 1.61e-16 81 24 6 275 3 slr1592 Uncharacterized RNA pseudouridine synthase slr1592 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9ZKP5 1.72e-16 80 30 7 196 3 jhp_0890 Uncharacterized RNA pseudouridine synthase jhp_0890 Helicobacter pylori (strain J99 / ATCC 700824)
O16686 3.8e-16 82 30 1 172 3 K07E8.7 Uncharacterized protein K07E8.7 Caenorhabditis elegans
Q69K07 4.11e-16 82 30 8 243 2 Os09g0103500 RNA pseudouridine synthase 4, mitochondrial Oryza sativa subsp. japonica
Q5XET6 9.02e-16 81 29 9 244 2 At1g78910 RNA pseudouridine synthase 3, mitochondrial Arabidopsis thaliana
Q5E9Z1 1.32e-15 80 27 7 238 2 RPUSD4 Pseudouridylate synthase RPUSD4, mitochondrial Bos taurus
O25610 2.63e-15 77 30 6 196 3 HP_0956 Uncharacterized RNA pseudouridine synthase HP_0956 Helicobacter pylori (strain ATCC 700392 / 26695)
Q96CM3 2.68e-15 79 27 4 198 1 RPUSD4 Pseudouridylate synthase RPUSD4, mitochondrial Homo sapiens
Q2QNM3 3.95e-15 78 28 10 257 2 Os12g0560500 RNA pseudouridine synthase 1 Oryza sativa subsp. japonica
Q4QQT0 5.35e-15 78 29 5 193 2 Rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Rattus norvegicus
Q17QT4 7.41e-15 77 30 8 240 2 RPUSD1 RNA pseudouridylate synthase domain-containing protein 1 Bos taurus
Q0DST9 2.72e-14 76 27 9 268 2 Os03g0288500 RNA pseudouridine synthase 5 Oryza sativa subsp. japonica
Q0J4D4 3.63e-14 76 30 7 227 2 Os08g0520100 RNA pseudouridine synthase 3, mitochondrial Oryza sativa subsp. japonica
Q9CWX4 1.02e-13 74 28 4 193 2 Rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Mus musculus
P75230 1.24e-13 73 27 12 291 3 MPN_548 Uncharacterized RNA pseudouridine synthase MG370 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q8VCZ8 2.15e-13 72 28 7 237 2 Rpusd1 RNA pseudouridylate synthase domain-containing protein 1 Mus musculus
Q6DBR0 5.17e-13 72 27 6 202 2 rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Danio rerio
O25114 2.96e-12 69 35 5 156 1 HP_0347 Uncharacterized RNA pseudouridine synthase HP_0347 Helicobacter pylori (strain ATCC 700392 / 26695)
Q7XA65 3.61e-12 69 26 8 252 2 At1g56345 RNA pseudouridine synthase 1 Arabidopsis thaliana
Q9ZMA1 4.55e-12 68 35 5 156 3 jhp_0321 Uncharacterized RNA pseudouridine synthase jhp_0321 Helicobacter pylori (strain J99 / ATCC 700824)
Q9UJJ7 6.43e-12 68 30 6 185 1 RPUSD1 RNA pseudouridylate synthase domain-containing protein 1 Homo sapiens
Q08C69 7.24e-12 68 32 7 175 2 rpusd1 RNA pseudouridylate synthase domain-containing protein 1 Danio rerio
P43930 1.02e-11 67 28 5 199 3 HI_0042 Uncharacterized RNA pseudouridine synthase HI_0042 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5M721 1.04e-10 65 29 5 198 2 At3g52260 RNA pseudouridine synthase 5 Arabidopsis thaliana
Q8I3Z1 4.36e-06 52 38 1 70 1 PFE0570w MATH and LRR domain-containing protein PFE0570w Plasmodium falciparum (isolate 3D7)
Q06244 5.35e-06 50 25 10 215 1 PUS5 21S rRNA pseudouridine(2819) synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07550
Feature type CDS
Gene rluC
Product 23S rRNA pseudouridine(955/2504/2580) synthase RluC
Location 1575183 - 1576142 (strand: -1)
Length 960 (nucleotides) / 319 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2004
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00849 RNA pseudouridylate synthase
PF01479 S4 domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0564 Translation, ribosomal structure and biogenesis (J) J Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06179 23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24] - -

Protein Sequence

MKTDNLAVHFVVVTDDEAGQRIDNFLLARLKGVPKSMIYRIIRKGEVRVNKGRIKPEYKLAEGDSVRIPPVRVAESNAAPVSAKLDKVAALADCVIYEDDHILVINKPAGTAVHGGSGLSFGVIEAMRALRPDARFLELVHRLDRDTSGILLIAKKRSALRALHEQLRLKQMQKDYLALVRGQWQSSVKSVQAPLLKNILQSGERVVKVNAEGKPSETRFKVEERFEHATLVKASPVTGRTHQIRVHTLHAGHPIAFDNRYGDSQFDEQLKGTGLNRLFLHAAALAFTHPATGETMHLQAPIDPKLRHCLTILRAKQEK

Flanking regions ( +/- flanking 50bp)

GAGCAATACCGGGTGACGGTGCAACAGTTCAGAGGATAGCCCCCCGTTTCATGAAAACTGATAATTTAGCCGTTCATTTCGTTGTTGTGACCGATGACGAAGCCGGACAACGCATTGATAATTTTCTGCTCGCCCGCCTGAAAGGGGTGCCGAAAAGCATGATTTACCGCATTATCCGCAAAGGCGAAGTGCGGGTGAACAAGGGCCGGATAAAACCGGAATACAAACTGGCGGAAGGTGACAGTGTCCGTATCCCGCCGGTGCGTGTGGCAGAATCAAATGCCGCACCTGTGTCGGCAAAGCTGGATAAAGTCGCGGCACTGGCAGATTGCGTTATCTATGAAGACGACCATATCCTGGTTATCAACAAACCGGCAGGCACCGCAGTTCATGGCGGCAGTGGTCTGAGTTTTGGTGTGATTGAAGCCATGCGTGCGCTGCGCCCTGATGCCCGGTTCCTGGAACTGGTGCATCGTCTTGACCGCGATACTTCCGGGATACTGCTTATTGCGAAGAAGCGCTCCGCATTGCGCGCGCTCCATGAGCAACTGCGTCTGAAACAAATGCAGAAAGATTATCTGGCGCTGGTGCGTGGACAGTGGCAGTCGTCGGTTAAGTCTGTTCAGGCACCGTTGCTCAAAAATATTCTGCAAAGCGGTGAACGTGTGGTGAAAGTTAATGCAGAAGGAAAACCATCAGAAACCCGTTTCAAAGTGGAAGAGCGTTTTGAGCATGCGACATTGGTGAAAGCAAGCCCGGTTACGGGGCGGACACATCAGATTCGCGTACACACGCTGCACGCGGGACACCCGATTGCCTTTGATAACCGTTACGGCGACAGCCAGTTTGATGAGCAACTGAAAGGCACAGGACTTAACCGCCTGTTTCTGCATGCGGCAGCGCTCGCGTTTACGCATCCGGCAACCGGGGAGACAATGCACCTTCAGGCACCAATCGATCCGAAACTGCGCCACTGTCTGACAATACTGCGCGCTAAGCAGGAAAAATAAACCCCGCCGGCAATGTTTGCCGGTGAATGAGTGATAACGGGCGGGCAAAT