Homologs in group_1285

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07145 FBDBKF_07145 80.3 Morganella morganii S1 serC 3-phosphoserine/phosphohydroxythreonine transaminase
EHELCC_03825 EHELCC_03825 80.3 Morganella morganii S2 serC 3-phosphoserine/phosphohydroxythreonine transaminase
NLDBIP_03825 NLDBIP_03825 80.3 Morganella morganii S4 serC 3-phosphoserine/phosphohydroxythreonine transaminase
LHKJJB_09655 LHKJJB_09655 80.3 Morganella morganii S3 serC 3-phosphoserine/phosphohydroxythreonine transaminase
HKOGLL_09320 HKOGLL_09320 80.3 Morganella morganii S5 serC 3-phosphoserine/phosphohydroxythreonine transaminase
F4V73_RS01330 F4V73_RS01330 81.7 Morganella psychrotolerans serC 3-phosphoserine/phosphohydroxythreonine transaminase

Distribution of the homologs in the orthogroup group_1285

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1285

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4ET24 0.0 756 100 0 362 3 serC Phosphoserine aminotransferase Proteus mirabilis (strain HI4320)
Q7N6D6 0.0 622 79 0 362 3 serC Phosphoserine aminotransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GCH0 0.0 615 79 1 362 3 serC Phosphoserine aminotransferase Serratia proteamaculans (strain 568)
P19689 0.0 592 75 1 362 3 serC Phosphoserine aminotransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DF64 0.0 588 75 1 362 3 serC Phosphoserine aminotransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q8RLW0 0.0 587 75 0 362 3 serC Phosphoserine aminotransferase Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)
Q6D400 0.0 587 75 1 362 3 serC Phosphoserine aminotransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4TN19 0.0 582 73 1 362 3 serC Phosphoserine aminotransferase Yersinia pestis (strain Pestoides F)
A9R7I1 0.0 582 73 1 362 3 serC Phosphoserine aminotransferase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGB4 0.0 582 73 1 362 3 serC Phosphoserine aminotransferase Yersinia pestis
Q1CA74 0.0 582 73 1 362 3 serC Phosphoserine aminotransferase Yersinia pestis bv. Antiqua (strain Antiqua)
Q66CI9 0.0 580 73 1 362 3 serC Phosphoserine aminotransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2KA22 0.0 580 73 1 362 3 serC Phosphoserine aminotransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B1JRE0 0.0 579 73 1 362 3 serC Phosphoserine aminotransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FJX0 0.0 579 73 1 362 3 serC Phosphoserine aminotransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2VC80 0.0 573 72 1 362 3 serC Phosphoserine aminotransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
P55900 0.0 568 72 0 362 1 serC Phosphoserine aminotransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4T141 0.0 568 72 0 362 3 serC Phosphoserine aminotransferase Salmonella newport (strain SL254)
Q2NUB0 0.0 566 72 1 362 3 serC Phosphoserine aminotransferase Sodalis glossinidius (strain morsitans)
P62677 0.0 565 72 0 362 3 serC Phosphoserine aminotransferase Salmonella typhi
B4TRT8 0.0 565 72 0 362 3 serC Phosphoserine aminotransferase Salmonella schwarzengrund (strain CVM19633)
A9N7V7 0.0 565 72 0 362 3 serC Phosphoserine aminotransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TD37 0.0 565 72 0 362 3 serC Phosphoserine aminotransferase Salmonella heidelberg (strain SL476)
P62676 0.0 565 72 0 362 3 serC Phosphoserine aminotransferase Salmonella gallinarum
B5R8J4 0.0 565 72 0 362 3 serC Phosphoserine aminotransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QYQ7 0.0 565 72 0 362 3 serC Phosphoserine aminotransferase Salmonella enteritidis PT4 (strain P125109)
B5FQ49 0.0 565 72 0 362 3 serC Phosphoserine aminotransferase Salmonella dublin (strain CT_02021853)
B5F159 0.0 565 72 0 362 3 serC Phosphoserine aminotransferase Salmonella agona (strain SL483)
C0PXU3 0.0 564 72 0 362 3 serC Phosphoserine aminotransferase Salmonella paratyphi C (strain RKS4594)
Q57R24 0.0 564 72 0 362 3 serC Phosphoserine aminotransferase Salmonella choleraesuis (strain SC-B67)
A4W8S7 0.0 561 70 0 362 3 serC Phosphoserine aminotransferase Enterobacter sp. (strain 638)
A8AIH6 0.0 560 71 0 362 3 serC Phosphoserine aminotransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7MES8 0.0 558 72 1 362 3 serC Phosphoserine aminotransferase Cronobacter sakazakii (strain ATCC BAA-894)
B7LN70 0.0 558 70 0 362 3 serC Phosphoserine aminotransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A9MHX6 0.0 557 71 0 362 3 serC Phosphoserine aminotransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q9X4H1 0.0 554 70 2 364 3 serC Phosphoserine aminotransferase Edwardsiella ictaluri (strain 93-146)
A6T700 0.0 553 70 0 362 1 serC Phosphoserine aminotransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XY88 0.0 552 69 0 362 3 serC Phosphoserine aminotransferase Klebsiella pneumoniae (strain 342)
B7NM68 0.0 551 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q3Z3L5 0.0 550 69 0 362 3 serC Phosphoserine aminotransferase Shigella sonnei (strain Ss046)
Q83LP3 0.0 550 69 0 362 3 serC Phosphoserine aminotransferase Shigella flexneri
B1LJV7 0.0 550 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli (strain SMS-3-5 / SECEC)
B6I8X9 0.0 550 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli (strain SE11)
P23721 0.0 550 69 0 362 1 serC Phosphoserine aminotransferase Escherichia coli (strain K12)
B1IW24 0.0 550 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FJB7 0.0 550 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJE6 0.0 550 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZYL0 0.0 550 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli O9:H4 (strain HS)
B1X847 0.0 550 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli (strain K12 / DH10B)
C4ZQ33 0.0 550 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M835 0.0 550 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli O8 (strain IAI1)
B7MS22 0.0 550 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli O81 (strain ED1a)
B7LD99 0.0 550 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli (strain 55989 / EAEC)
B7NAQ6 0.0 550 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q1RDV1 0.0 549 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli (strain UTI89 / UPEC)
A1A9I4 0.0 549 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli O1:K1 / APEC
B7MHL6 0.0 549 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZJZ6 0.0 549 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q31YU4 0.0 549 69 0 362 3 serC Phosphoserine aminotransferase Shigella boydii serotype 4 (strain Sb227)
B5YT41 0.0 549 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XEA7 0.0 549 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli O157:H7
B2TUH4 0.0 548 68 0 362 3 serC Phosphoserine aminotransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q32E24 0.0 548 69 0 362 3 serC Phosphoserine aminotransferase Shigella dysenteriae serotype 1 (strain Sd197)
B7UMZ3 0.0 548 69 0 362 3 serC Phosphoserine aminotransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q6LPD9 0.0 522 66 1 362 3 serC Phosphoserine aminotransferase Photobacterium profundum (strain SS9)
Q87QA3 0.0 512 66 1 359 3 serC Phosphoserine aminotransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MLH6 0.0 510 66 1 359 3 serC Phosphoserine aminotransferase Vibrio vulnificus (strain YJ016)
Q8D900 0.0 508 66 1 359 3 serC Phosphoserine aminotransferase Vibrio vulnificus (strain CMCP6)
C4K3B1 8.18e-179 503 65 3 368 3 serC Phosphoserine aminotransferase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q5E6F2 5.24e-178 501 63 1 361 3 serC Phosphoserine aminotransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q1LTL2 2.67e-177 499 64 3 364 3 serC Phosphoserine aminotransferase Baumannia cicadellinicola subsp. Homalodisca coagulata
B5FCJ8 2.77e-177 499 63 1 361 3 serC Phosphoserine aminotransferase Aliivibrio fischeri (strain MJ11)
Q9KSU7 9.03e-168 475 63 1 359 3 serC Phosphoserine aminotransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P81435 5.69e-165 468 58 1 362 3 serC Phosphoserine aminotransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B8D7K4 7.73e-158 450 57 1 362 3 serC Phosphoserine aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57397 1.2e-157 449 57 1 362 3 serC Phosphoserine aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9A2 1.2e-157 449 57 1 362 3 serC Phosphoserine aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q492S5 5.33e-156 445 56 2 362 3 serC Phosphoserine aminotransferase Blochmanniella pennsylvanica (strain BPEN)
P59492 2.23e-153 439 52 1 367 3 serC Phosphoserine aminotransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q6F961 1.19e-152 436 57 1 360 3 serC Phosphoserine aminotransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B2HWW3 5.16e-151 432 57 1 360 3 serC Phosphoserine aminotransferase Acinetobacter baumannii (strain ACICU)
Q5QZ48 7.35e-151 432 56 3 362 3 serC Phosphoserine aminotransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A3M7Z0 4.69e-150 430 57 1 360 3 serC Phosphoserine aminotransferase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B7I5D6 4.69e-150 430 57 1 360 3 serC Phosphoserine aminotransferase Acinetobacter baumannii (strain AB0057)
B7GY87 4.69e-150 430 57 1 360 3 serC Phosphoserine aminotransferase Acinetobacter baumannii (strain AB307-0294)
Q7VR40 1.99e-149 429 52 2 365 3 serC Phosphoserine aminotransferase Blochmanniella floridana
Q3SK88 3.55e-148 425 56 3 359 3 serC Phosphoserine aminotransferase Thiobacillus denitrificans (strain ATCC 25259)
A4XTE7 1.87e-144 416 55 2 360 3 serC Phosphoserine aminotransferase Pseudomonas mendocina (strain ymp)
Q65S80 6.28e-144 414 54 1 362 3 serC Phosphoserine aminotransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q057N5 5.41e-143 412 51 3 362 3 serC Phosphoserine aminotransferase Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q0I322 9.08e-143 411 55 2 356 3 serC Phosphoserine aminotransferase Histophilus somni (strain 129Pt)
Q4ZQ94 1.14e-142 411 56 2 360 3 serC Phosphoserine aminotransferase Pseudomonas syringae pv. syringae (strain B728a)
Q3ILA3 2.93e-142 410 51 1 358 3 serC Phosphoserine aminotransferase Pseudoalteromonas translucida (strain TAC 125)
Q885T5 1.13e-141 409 56 2 360 3 serC Phosphoserine aminotransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
C1DRQ9 2.61e-141 408 54 2 360 3 serC Phosphoserine aminotransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q02PX3 7.44e-141 407 55 2 360 3 serC Phosphoserine aminotransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V9J9 7.44e-141 407 55 2 360 3 serC Phosphoserine aminotransferase Pseudomonas aeruginosa (strain LESB58)
Q9HZ66 1.99e-140 405 55 2 360 1 serC Phosphoserine aminotransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1IDA2 3.62e-140 405 53 2 360 3 serC Phosphoserine aminotransferase Pseudomonas entomophila (strain L48)
Q88M07 5.25e-140 404 54 2 360 3 serC Phosphoserine aminotransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q12MU6 5.39e-140 405 53 2 365 3 serC Phosphoserine aminotransferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q2SCF2 7.37e-140 404 55 2 358 3 serC Phosphoserine aminotransferase Hahella chejuensis (strain KCTC 2396)
Q7VLP0 1.16e-139 404 53 2 362 3 serC Phosphoserine aminotransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q820S0 2.35e-139 403 53 4 369 3 serC Phosphoserine aminotransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P44336 2.54e-139 403 54 2 361 3 serC Phosphoserine aminotransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9RI02 3.67e-139 402 53 2 360 3 serC Phosphoserine aminotransferase Stutzerimonas stutzeri
A1S6D1 1.37e-138 401 53 2 365 3 serC Phosphoserine aminotransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
C1D8N3 1.86e-138 400 54 3 360 3 serC Phosphoserine aminotransferase Laribacter hongkongensis (strain HLHK9)
C3K6J5 2.62e-138 400 55 2 360 3 serC Phosphoserine aminotransferase Pseudomonas fluorescens (strain SBW25)
A6V2Q8 9.7e-138 399 54 2 360 3 serC Phosphoserine aminotransferase Pseudomonas aeruginosa (strain PA7)
A4JCH1 1.6e-137 398 52 1 360 3 serC Phosphoserine aminotransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
B5EPR5 6.29e-137 397 55 4 361 3 serC Phosphoserine aminotransferase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J6V1 6.29e-137 397 55 4 361 3 serC Phosphoserine aminotransferase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q7NVP1 8.08e-137 396 54 2 363 3 serC Phosphoserine aminotransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A0KWN5 1.19e-136 396 52 2 365 3 serC Phosphoserine aminotransferase Shewanella sp. (strain ANA-3)
Q39IG4 1.48e-136 396 52 1 360 3 serC Phosphoserine aminotransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0HIX3 2.05e-136 395 52 2 365 3 serC Phosphoserine aminotransferase Shewanella sp. (strain MR-4)
Q081U0 5.77e-136 394 53 3 365 3 serC Phosphoserine aminotransferase Shewanella frigidimarina (strain NCIMB 400)
A9ADV9 7.8e-136 394 51 1 360 3 serC Phosphoserine aminotransferase Burkholderia multivorans (strain ATCC 17616 / 249)
B4EB45 1.45e-135 393 51 1 360 3 serC Phosphoserine aminotransferase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B0TT41 1.92e-135 393 53 2 365 3 serC Phosphoserine aminotransferase Shewanella halifaxensis (strain HAW-EB4)
Q0HV09 1.98e-135 393 52 2 365 3 serC Phosphoserine aminotransferase Shewanella sp. (strain MR-7)
B1YV30 2.43e-135 393 52 1 360 3 serC Phosphoserine aminotransferase Burkholderia ambifaria (strain MC40-6)
A8H4A2 2.49e-135 393 54 3 365 3 serC Phosphoserine aminotransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q0BH96 2.74e-135 392 52 1 360 3 serC Phosphoserine aminotransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A3D4A1 3.07e-135 392 52 2 365 3 serC Phosphoserine aminotransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A9L2Y2 4.25e-135 392 52 2 365 3 serC Phosphoserine aminotransferase Shewanella baltica (strain OS195)
Q8EEH2 6.18e-135 392 52 3 367 3 serC Phosphoserine aminotransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B8EA90 8.01e-135 391 52 2 365 3 serC Phosphoserine aminotransferase Shewanella baltica (strain OS223)
B1JXR6 8.33e-135 391 51 1 360 3 serC Phosphoserine aminotransferase Burkholderia orbicola (strain MC0-3)
Q1BY31 1.16e-134 391 51 1 360 3 serC Phosphoserine aminotransferase Burkholderia orbicola (strain AU 1054)
A0K5L8 1.16e-134 391 51 1 360 3 serC Phosphoserine aminotransferase Burkholderia cenocepacia (strain HI2424)
P57881 2.02e-134 390 53 2 358 3 serC Phosphoserine aminotransferase Pasteurella multocida (strain Pm70)
A6WNN5 3.07e-134 390 52 2 365 3 serC Phosphoserine aminotransferase Shewanella baltica (strain OS185)
B1KF45 5.13e-134 389 52 4 366 3 serC Phosphoserine aminotransferase Shewanella woodyi (strain ATCC 51908 / MS32)
B2T637 3.97e-133 387 50 1 360 3 serC Phosphoserine aminotransferase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A8FVN8 2.14e-132 385 52 2 364 3 serC Phosphoserine aminotransferase Shewanella sediminis (strain HAW-EB3)
A1RJD3 2.63e-132 385 52 2 364 3 serC Phosphoserine aminotransferase Shewanella sp. (strain W3-18-1)
A4Y757 5.65e-132 384 52 2 364 3 serC Phosphoserine aminotransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A5CWI0 6.4e-132 384 50 2 362 3 serC Phosphoserine aminotransferase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q21Y51 1.21e-131 384 50 3 371 3 serC Phosphoserine aminotransferase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B4SP45 7.23e-131 381 51 3 362 3 serC Phosphoserine aminotransferase Stenotrophomonas maltophilia (strain R551-3)
B2JF00 7.38e-131 381 50 1 360 3 serC Phosphoserine aminotransferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q5P7U7 8.48e-131 381 51 4 367 3 serC Phosphoserine aminotransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B2FKF0 1.3e-130 380 51 3 362 1 serC Phosphoserine aminotransferase Stenotrophomonas maltophilia (strain K279a)
A4G865 3.56e-129 377 50 4 366 3 serC Phosphoserine aminotransferase Herminiimonas arsenicoxydans
Q8D268 7.54e-129 376 48 3 363 3 serC Phosphoserine aminotransferase Wigglesworthia glossinidia brevipalpis
A6T1G7 1.2e-128 376 49 4 366 3 serC Phosphoserine aminotransferase Janthinobacterium sp. (strain Marseille)
A9BM04 1.42e-128 376 51 7 372 3 serC Phosphoserine aminotransferase Delftia acidovorans (strain DSM 14801 / SPH-1)
A1TSA3 5.97e-128 374 50 4 371 3 serC Phosphoserine aminotransferase Paracidovorax citrulli (strain AAC00-1)
A1AWS0 7.19e-128 374 50 2 362 3 serC Phosphoserine aminotransferase Ruthia magnifica subsp. Calyptogena magnifica
Q9SHP0 1.36e-127 375 52 4 363 1 PSAT2 Phosphoserine aminotransferase 2, chloroplastic Arabidopsis thaliana
Q8Y0Z0 1.12e-126 371 51 3 367 3 serC Phosphoserine aminotransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q96255 2.47e-126 372 50 4 362 1 PSAT1 Phosphoserine aminotransferase 1, chloroplastic Arabidopsis thaliana
B6J1E0 4.64e-126 369 50 3 363 3 serC Phosphoserine aminotransferase Coxiella burnetii (strain CbuG_Q212)
A9KCT6 7.34e-126 369 50 3 363 3 serC Phosphoserine aminotransferase Coxiella burnetii (strain Dugway 5J108-111)
B8CMG9 1.22e-125 368 50 2 365 3 serC Phosphoserine aminotransferase Shewanella piezotolerans (strain WP3 / JCM 13877)
B2U882 1.48e-125 369 50 3 367 3 serC Phosphoserine aminotransferase Ralstonia pickettii (strain 12J)
B6J893 3.23e-125 367 50 3 363 3 serC Phosphoserine aminotransferase Coxiella burnetii (strain CbuK_Q154)
Q83E12 4.2e-125 367 50 3 363 3 serC Phosphoserine aminotransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
B2SJJ1 8.45e-125 366 49 3 362 3 serC Phosphoserine aminotransferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
A1VR16 1.09e-124 366 48 5 371 3 serC Phosphoserine aminotransferase Polaromonas naphthalenivorans (strain CJ2)
Q8PLY7 1.36e-124 365 49 3 362 3 serC Phosphoserine aminotransferase Xanthomonas axonopodis pv. citri (strain 306)
Q3BUZ3 1.38e-124 365 49 3 362 3 serC Phosphoserine aminotransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q5H079 2.62e-124 365 49 3 362 3 serC Phosphoserine aminotransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P354 2.62e-124 365 49 3 362 3 serC Phosphoserine aminotransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A9NC17 3.33e-124 364 50 3 363 3 serC Phosphoserine aminotransferase Coxiella burnetii (strain RSA 331 / Henzerling II)
Q12CL3 4.31e-124 364 48 5 371 3 serC Phosphoserine aminotransferase Polaromonas sp. (strain JS666 / ATCC BAA-500)
A6VZ92 3.91e-123 362 48 2 361 3 serC Phosphoserine aminotransferase Marinomonas sp. (strain MWYL1)
Q2L2T1 6.17e-122 359 48 5 377 3 serC Phosphoserine aminotransferase Bordetella avium (strain 197N)
Q8PA97 7.35e-122 358 47 4 367 3 serC Phosphoserine aminotransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UTC9 7.35e-122 358 47 4 367 3 serC Phosphoserine aminotransferase Xanthomonas campestris pv. campestris (strain 8004)
Q7VZG4 1.42e-120 356 47 5 377 3 serC Phosphoserine aminotransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B0RUW3 1.91e-120 355 47 4 367 3 serC Phosphoserine aminotransferase Xanthomonas campestris pv. campestris (strain B100)
Q7W5Z9 3.05e-120 355 47 5 377 3 serC Phosphoserine aminotransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WGU2 3.05e-120 355 47 5 377 3 serC Phosphoserine aminotransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q71VT6 2.96e-117 347 50 4 357 3 serC Phosphoserine aminotransferase Listeria monocytogenes serotype 4b (strain F2365)
Q87BU0 1.67e-116 345 48 3 361 3 serC Phosphoserine aminotransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8Y3L0 2.15e-116 345 50 4 357 3 serC Phosphoserine aminotransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
A9IJI3 2.57e-116 345 46 5 376 3 serC Phosphoserine aminotransferase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
P52877 1.28e-115 345 48 5 371 1 PSA Phosphoserine aminotransferase, chloroplastic Spinacia oleracea
Q5F7A0 1.58e-115 343 48 4 366 3 serC Phosphoserine aminotransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9PB19 1.64e-115 342 48 3 361 3 serC Phosphoserine aminotransferase Xylella fastidiosa (strain 9a5c)
Q926T3 4.43e-115 341 49 4 357 3 serC Phosphoserine aminotransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q81BC0 3.95e-114 339 46 3 359 3 serC Phosphoserine aminotransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q88ZU5 4.7e-114 338 47 5 363 3 serC Phosphoserine aminotransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P57007 6.67e-114 338 47 4 366 3 serC Phosphoserine aminotransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q734W9 2.51e-113 337 46 3 359 3 serC Phosphoserine aminotransferase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q9VAN0 3.03e-113 337 46 4 364 2 CG11899 Probable phosphoserine aminotransferase Drosophila melanogaster
O34370 4.84e-113 336 47 4 366 3 serC Phosphoserine aminotransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q638W1 5.27e-113 336 46 3 359 3 serC Phosphoserine aminotransferase Bacillus cereus (strain ZK / E33L)
A1KV48 1.12e-112 335 47 4 366 3 serC Phosphoserine aminotransferase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q5ZVM2 2.34e-112 334 44 4 367 3 serC Phosphoserine aminotransferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q031D5 5.54e-112 333 48 9 380 3 serC Phosphoserine aminotransferase Lactococcus lactis subsp. cremoris (strain SK11)
Q6HGI0 9.33e-112 333 45 2 358 3 serC Phosphoserine aminotransferase Bacillus thuringiensis subsp. konkukian (strain 97-27)
A5IBR0 2.13e-111 332 44 4 367 3 serC Phosphoserine aminotransferase Legionella pneumophila (strain Corby)
Q5X5E7 2.38e-111 332 44 4 367 3 serC Phosphoserine aminotransferase Legionella pneumophila (strain Paris)
A2RIS2 4.19e-111 331 47 9 380 3 serC Phosphoserine aminotransferase Lactococcus lactis subsp. cremoris (strain MG1363)
Q5WWT0 1.6e-110 330 44 4 367 3 serC Phosphoserine aminotransferase Legionella pneumophila (strain Lens)
Q9CHW5 1.84e-110 330 49 9 367 3 serC Phosphoserine aminotransferase Lactococcus lactis subsp. lactis (strain IL1403)
C3P210 4.16e-110 328 45 3 359 3 serC Phosphoserine aminotransferase Bacillus anthracis (strain A0248)
A9B6Q3 6.22e-110 328 46 3 360 3 serC Phosphoserine aminotransferase Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q9KDM4 7.2e-109 325 46 3 362 3 serC Phosphoserine aminotransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A3CPJ2 1.2e-108 325 47 5 364 3 serC Phosphoserine aminotransferase Streptococcus sanguinis (strain SK36)
Q99K85 2.33e-108 324 45 6 366 1 Psat1 Phosphoserine aminotransferase Mus musculus
P10658 4.62e-108 323 45 6 366 2 PSAT1 Phosphoserine aminotransferase Oryctolagus cuniculus
Q59196 5.1e-108 323 44 3 358 1 serC Phosphoserine aminotransferase Niallia circulans
A8YW78 6.82e-108 323 44 2 358 3 serC Phosphoserine aminotransferase Lactobacillus helveticus (strain DPC 4571)
Q5L296 7.22e-108 323 46 3 363 3 serC Phosphoserine aminotransferase Geobacillus kaustophilus (strain HTA426)
Q9Y617 4.15e-107 321 45 6 366 1 PSAT1 Phosphoserine aminotransferase Homo sapiens
Q6ALW3 1.84e-106 319 47 2 355 3 serC Phosphoserine aminotransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B1HSU6 2.27e-106 319 44 3 360 3 serC Phosphoserine aminotransferase Lysinibacillus sphaericus (strain C3-41)
Q8F930 3.25e-106 318 47 3 359 3 serC Phosphoserine aminotransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72VI2 3.25e-106 318 47 3 359 3 serC Phosphoserine aminotransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B8FLC3 7.83e-106 318 45 4 362 3 serC Phosphoserine aminotransferase Desulfatibacillum aliphaticivorans
Q5WHT9 7.68e-105 315 46 7 365 3 serC Phosphoserine aminotransferase Shouchella clausii (strain KSM-K16)
Q9RME2 1.24e-104 315 44 3 359 1 serC Phosphoserine aminotransferase Alkalihalobacillus alcalophilus
A4VU42 1.79e-104 314 46 5 364 3 serC Phosphoserine aminotransferase Streptococcus suis (strain 05ZYH33)
A4W0D4 1.79e-104 314 46 5 364 3 serC Phosphoserine aminotransferase Streptococcus suis (strain 98HAH33)
P91856 1.95e-103 312 43 3 361 3 F26H9.5 Probable phosphoserine aminotransferase Caenorhabditis elegans
Q8DSV3 4.28e-103 311 46 5 360 3 serC Phosphoserine aminotransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A9A0A5 9.38e-102 307 45 4 361 3 serC Phosphoserine aminotransferase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q1D2L9 2.19e-101 306 44 3 357 3 serC Phosphoserine aminotransferase Myxococcus xanthus (strain DK1622)
B0SKW4 6.26e-100 303 43 3 361 3 serC Phosphoserine aminotransferase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SCE2 6.26e-100 303 43 3 361 3 serC Phosphoserine aminotransferase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
B9DTW4 6.47e-100 303 45 5 364 3 serC Phosphoserine aminotransferase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q55CQ6 1.46e-99 302 42 6 366 3 serC Probable phosphoserine aminotransferase Dictyostelium discoideum
Q8E3Y3 4.62e-99 300 44 5 364 3 serC Phosphoserine aminotransferase Streptococcus agalactiae serotype III (strain NEM316)
Q7UQL3 6.83e-99 300 45 4 363 3 serC Phosphoserine aminotransferase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q03JH6 5.55e-98 298 45 6 364 3 serC Phosphoserine aminotransferase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5LYP0 5.55e-98 298 45 6 364 3 serC Phosphoserine aminotransferase Streptococcus thermophilus (strain CNRZ 1066)
Q5M3A4 7.35e-97 295 45 6 361 3 serC Phosphoserine aminotransferase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
B6YQL2 5.93e-96 292 41 5 360 3 serC Phosphoserine aminotransferase Azobacteroides pseudotrichonymphae genomovar. CFP2
Q8A8L4 1.4e-95 291 41 5 359 3 serC Phosphoserine aminotransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A0LK14 1.77e-95 291 42 5 367 3 serC Phosphoserine aminotransferase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B2GBS2 1.87e-93 286 43 5 358 3 serC Phosphoserine aminotransferase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
A6L9B7 5.59e-93 285 40 5 359 3 serC Phosphoserine aminotransferase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q64UR4 6.51e-93 285 40 5 359 3 serC Phosphoserine aminotransferase Bacteroides fragilis (strain YCH46)
Q5LDN9 6.51e-93 285 40 5 359 3 serC Phosphoserine aminotransferase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q7MV30 4.05e-92 283 41 5 362 3 serC Phosphoserine aminotransferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RID6 4.05e-92 283 41 5 362 3 serC Phosphoserine aminotransferase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q9PIH3 4.28e-92 282 41 7 360 1 serC Phosphoserine aminotransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7H543 4.52e-92 282 41 7 360 3 serC Phosphoserine aminotransferase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
B9KDM7 9.05e-92 281 41 8 367 3 serC Phosphoserine aminotransferase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A1VY45 1.47e-90 278 40 7 360 3 serC Phosphoserine aminotransferase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q5HWE5 3.31e-90 278 41 7 360 3 serC Phosphoserine aminotransferase Campylobacter jejuni (strain RM1221)
A8FKB5 5.04e-90 277 41 7 360 3 serC Phosphoserine aminotransferase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
P80862 2.04e-89 276 40 5 364 1 serC Phosphoserine aminotransferase Bacillus subtilis (strain 168)
A6L5A6 4.18e-89 275 41 6 360 3 serC Phosphoserine aminotransferase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
C4L432 4.04e-87 270 40 5 355 3 serC Phosphoserine aminotransferase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A5EV80 1.29e-85 266 39 4 360 3 serC Phosphoserine aminotransferase Dichelobacter nodosus (strain VCS1703A)
A5FH28 1.08e-84 263 40 4 357 3 serC Phosphoserine aminotransferase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
A6GXC2 5.9e-81 254 39 4 358 3 serC Phosphoserine aminotransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q03W65 6.15e-78 246 37 1 358 3 serC Phosphoserine aminotransferase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
P33330 1.73e-77 246 38 9 386 1 SER1 Phosphoserine aminotransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q10349 6.19e-76 242 35 6 383 3 SPAC1F12.07 Putative phosphoserine aminotransferase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A1TF55 5.97e-15 78 26 11 328 3 serC Putative phosphoserine aminotransferase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q1B3G6 1.26e-12 71 24 8 257 3 serC Putative phosphoserine aminotransferase Mycobacterium sp. (strain MCS)
A1ULN4 1.26e-12 71 24 8 257 3 serC Putative phosphoserine aminotransferase Mycobacterium sp. (strain KMS)
A3Q635 1.26e-12 71 24 8 257 3 serC Putative phosphoserine aminotransferase Mycobacterium sp. (strain JLS)
Q742L2 5.38e-11 67 24 9 296 3 serC Putative phosphoserine aminotransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBI3 7.54e-11 66 24 9 296 3 serC Putative phosphoserine aminotransferase Mycobacterium avium (strain 104)
C1ATN6 1.11e-10 65 24 9 266 3 serC Phosphoserine aminotransferase Rhodococcus opacus (strain B4)
O33062 2.39e-10 65 24 10 283 3 serC Putative phosphoserine aminotransferase Mycobacterium leprae (strain TN)
P9WQ73 3.47e-10 64 24 10 285 1 serC Phosphoserine aminotransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ72 3.47e-10 64 24 10 285 3 serC Phosphoserine aminotransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63515 3.47e-10 64 24 10 285 3 serC Putative phosphoserine aminotransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q0S6R3 7.02e-10 63 24 9 266 3 serC Phosphoserine aminotransferase Rhodococcus jostii (strain RHA1)
A1SEM0 1.47e-08 59 20 11 367 3 serC Phosphoserine aminotransferase Nocardioides sp. (strain ATCC BAA-499 / JS614)
A4QCG9 1.49e-08 59 23 13 343 3 serC Phosphoserine aminotransferase Corynebacterium glutamicum (strain R)
Q8TNI1 0.000564 45 23 11 282 3 serC Phosphoserine aminotransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03500
Feature type CDS
Gene serC
Product 3-phosphoserine/phosphohydroxythreonine transaminase
Location 779999 - 781087 (strand: 1)
Length 1089 (nucleotides) / 362 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1285
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00266 Aminotransferase class-V

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1932 Coenzyme transport and metabolism (H)
Amino acid transport and metabolism (E)
HE Phosphoserine aminotransferase

Kegg Ortholog Annotation(s)

Protein Sequence

MSQVYNFSAGPAMLPAEVLRRAELELCNWHGLGRSVMEISHRSKEFLEVAHQAEQDLRDLLNVPENYKILFCHGGARGHFAALPLNLLGEKTTADYIDGGYWAKSAADEAEKYCSPNIIKIKTEIDGKIAVKPMKEWQLSDNAAYVHYCPNETIDGIAIHEEPDFDDKKIVIADYSSAILSQPLDVSRFGMIYAGAQKNIGPAGLTLVIIREDLLGKARKETPSVFDYTVLAENDSMFNTPPTFAWYLSGMVFKWLKEQGGLQEIAKRNYEKATLLYSAIDNSDFYINRIATENRSLMNVPFQMSSPALDAVFLKEAEEQGLVALKGHRVSGGMRASIYNAMPFAGVQALVDFMADFERRHA

Flanking regions ( +/- flanking 50bp)

AACCGATAGAGGTCGTTTTGTCAAAACATATTCAGATAGGGTGAATTTGAATGAGTCAGGTATATAACTTTAGTGCAGGTCCGGCCATGTTACCGGCAGAAGTTCTTCGTCGTGCAGAATTAGAATTATGCAACTGGCACGGATTAGGGCGTTCTGTTATGGAGATCAGCCACCGCAGTAAAGAATTTTTGGAGGTTGCCCATCAGGCAGAGCAAGATCTACGGGATCTACTCAATGTACCAGAAAATTATAAAATTCTGTTCTGTCATGGTGGCGCTCGTGGTCATTTTGCGGCATTACCGCTTAATTTATTAGGTGAGAAAACCACCGCTGATTATATCGATGGAGGATATTGGGCTAAAAGTGCTGCCGATGAAGCGGAAAAATATTGTTCACCTAATATCATTAAAATAAAGACAGAAATTGACGGTAAAATCGCGGTTAAACCAATGAAAGAGTGGCAATTAAGTGATAATGCAGCCTATGTGCATTATTGCCCAAATGAGACTATCGATGGGATTGCTATCCACGAAGAGCCGGATTTTGATGATAAAAAAATTGTTATTGCCGACTACTCTTCCGCTATTTTATCTCAGCCACTTGATGTTAGCCGTTTTGGCATGATTTACGCTGGAGCACAAAAAAATATTGGTCCTGCGGGGTTAACATTGGTAATTATTCGCGAAGATTTACTGGGTAAAGCACGTAAAGAAACCCCTTCAGTATTTGATTACACAGTACTGGCTGAAAATGACTCCATGTTTAATACACCGCCGACTTTTGCTTGGTACTTATCAGGCATGGTGTTTAAATGGTTAAAAGAGCAAGGTGGCTTGCAAGAGATAGCAAAACGCAATTATGAGAAAGCGACACTGCTTTATAGTGCGATTGATAACAGTGATTTCTATATTAACCGTATTGCCACAGAAAACCGCTCTTTGATGAACGTACCTTTCCAAATGTCTTCTCCTGCTTTAGATGCGGTTTTCTTAAAAGAAGCTGAAGAGCAAGGATTAGTTGCGCTGAAAGGGCACCGTGTTTCAGGCGGTATGCGTGCATCTATTTATAACGCAATGCCTTTTGCTGGTGTACAAGCATTAGTTGATTTTATGGCTGATTTTGAGCGTCGCCACGCTTAATGGTTACCTTTTCACTGCTGCAAAACCTGCCTTATTGGCAGGTTTTCTGA