Homologs in group_1226

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07145 FBDBKF_07145 100.0 Morganella morganii S1 serC 3-phosphoserine/phosphohydroxythreonine transaminase
NLDBIP_03825 NLDBIP_03825 100.0 Morganella morganii S4 serC 3-phosphoserine/phosphohydroxythreonine transaminase
LHKJJB_09655 LHKJJB_09655 100.0 Morganella morganii S3 serC 3-phosphoserine/phosphohydroxythreonine transaminase
HKOGLL_09320 HKOGLL_09320 100.0 Morganella morganii S5 serC 3-phosphoserine/phosphohydroxythreonine transaminase
F4V73_RS01330 F4V73_RS01330 91.7 Morganella psychrotolerans serC 3-phosphoserine/phosphohydroxythreonine transaminase
PMI_RS03500 PMI_RS03500 80.3 Proteus mirabilis HI4320 serC 3-phosphoserine/phosphohydroxythreonine transaminase

Distribution of the homologs in the orthogroup group_1226

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1226

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4ET24 0.0 623 80 1 362 3 serC Phosphoserine aminotransferase Proteus mirabilis (strain HI4320)
Q7N6D6 0.0 605 78 1 361 3 serC Phosphoserine aminotransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GCH0 0.0 591 75 0 360 3 serC Phosphoserine aminotransferase Serratia proteamaculans (strain 568)
P19689 0.0 587 75 0 360 3 serC Phosphoserine aminotransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8RLW0 0.0 586 75 1 361 3 serC Phosphoserine aminotransferase Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)
C6DF64 0.0 578 74 0 360 3 serC Phosphoserine aminotransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D400 0.0 577 74 0 360 3 serC Phosphoserine aminotransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A9R7I1 0.0 574 73 0 360 3 serC Phosphoserine aminotransferase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGB4 0.0 574 73 0 360 3 serC Phosphoserine aminotransferase Yersinia pestis
Q1CA74 0.0 574 73 0 360 3 serC Phosphoserine aminotransferase Yersinia pestis bv. Antiqua (strain Antiqua)
Q66CI9 0.0 572 73 0 360 3 serC Phosphoserine aminotransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2KA22 0.0 572 73 0 360 3 serC Phosphoserine aminotransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A4TN19 0.0 572 73 0 360 3 serC Phosphoserine aminotransferase Yersinia pestis (strain Pestoides F)
B1JRE0 0.0 571 72 0 360 3 serC Phosphoserine aminotransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FJX0 0.0 571 72 0 360 3 serC Phosphoserine aminotransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2VC80 0.0 561 71 0 360 3 serC Phosphoserine aminotransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4W8S7 0.0 546 70 1 361 3 serC Phosphoserine aminotransferase Enterobacter sp. (strain 638)
Q2NUB0 0.0 544 69 0 360 3 serC Phosphoserine aminotransferase Sodalis glossinidius (strain morsitans)
A7MES8 0.0 543 70 0 360 3 serC Phosphoserine aminotransferase Cronobacter sakazakii (strain ATCC BAA-894)
Q9X4H1 0.0 540 69 1 362 3 serC Phosphoserine aminotransferase Edwardsiella ictaluri (strain 93-146)
B7LN70 0.0 539 68 1 361 3 serC Phosphoserine aminotransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P55900 0.0 538 69 1 361 1 serC Phosphoserine aminotransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4T141 0.0 538 69 1 361 3 serC Phosphoserine aminotransferase Salmonella newport (strain SL254)
A8AIH6 0.0 536 69 1 361 3 serC Phosphoserine aminotransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8FJB7 0.0 535 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJE6 0.0 535 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MS22 0.0 535 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli O81 (strain ED1a)
B5YT41 0.0 535 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XEA7 0.0 535 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli O157:H7
P62677 0.0 534 69 1 361 3 serC Phosphoserine aminotransferase Salmonella typhi
B4TRT8 0.0 534 69 1 361 3 serC Phosphoserine aminotransferase Salmonella schwarzengrund (strain CVM19633)
C0PXU3 0.0 534 69 1 361 3 serC Phosphoserine aminotransferase Salmonella paratyphi C (strain RKS4594)
A9N7V7 0.0 534 69 1 361 3 serC Phosphoserine aminotransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TD37 0.0 534 69 1 361 3 serC Phosphoserine aminotransferase Salmonella heidelberg (strain SL476)
P62676 0.0 534 69 1 361 3 serC Phosphoserine aminotransferase Salmonella gallinarum
B5R8J4 0.0 534 69 1 361 3 serC Phosphoserine aminotransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QYQ7 0.0 534 69 1 361 3 serC Phosphoserine aminotransferase Salmonella enteritidis PT4 (strain P125109)
B5FQ49 0.0 534 69 1 361 3 serC Phosphoserine aminotransferase Salmonella dublin (strain CT_02021853)
Q57R24 0.0 534 69 1 361 3 serC Phosphoserine aminotransferase Salmonella choleraesuis (strain SC-B67)
B5F159 0.0 534 69 1 361 3 serC Phosphoserine aminotransferase Salmonella agona (strain SL483)
Q1RDV1 0.0 534 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli (strain UTI89 / UPEC)
A1A9I4 0.0 534 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli O1:K1 / APEC
B7MHL6 0.0 534 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7NM68 0.0 533 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7UMZ3 0.0 533 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3Z3L5 0.0 533 68 1 361 3 serC Phosphoserine aminotransferase Shigella sonnei (strain Ss046)
Q83LP3 0.0 533 68 1 361 3 serC Phosphoserine aminotransferase Shigella flexneri
B1LJV7 0.0 533 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli (strain SMS-3-5 / SECEC)
B6I8X9 0.0 533 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli (strain SE11)
B1IW24 0.0 533 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZYL0 0.0 533 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli O9:H4 (strain HS)
B7M835 0.0 533 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli O8 (strain IAI1)
B7LD99 0.0 533 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli (strain 55989 / EAEC)
Q32E24 0.0 532 68 1 361 3 serC Phosphoserine aminotransferase Shigella dysenteriae serotype 1 (strain Sd197)
P23721 0.0 532 68 1 361 1 serC Phosphoserine aminotransferase Escherichia coli (strain K12)
B1X847 0.0 532 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli (strain K12 / DH10B)
C4ZQ33 0.0 532 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli (strain K12 / MC4100 / BW2952)
A7ZJZ6 0.0 532 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
A9MHX6 0.0 532 69 1 361 3 serC Phosphoserine aminotransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7NAQ6 0.0 532 68 1 361 3 serC Phosphoserine aminotransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q31YU4 0.0 531 68 1 361 3 serC Phosphoserine aminotransferase Shigella boydii serotype 4 (strain Sb227)
B2TUH4 0.0 531 68 1 361 3 serC Phosphoserine aminotransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A6T700 0.0 530 68 1 361 1 serC Phosphoserine aminotransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XY88 0.0 527 67 1 361 3 serC Phosphoserine aminotransferase Klebsiella pneumoniae (strain 342)
Q6LPD9 5.86e-180 506 64 1 361 3 serC Phosphoserine aminotransferase Photobacterium profundum (strain SS9)
Q8D900 3.66e-177 499 64 1 358 3 serC Phosphoserine aminotransferase Vibrio vulnificus (strain CMCP6)
Q7MLH6 1.33e-176 497 64 1 358 3 serC Phosphoserine aminotransferase Vibrio vulnificus (strain YJ016)
Q87QA3 6.51e-176 496 63 1 358 3 serC Phosphoserine aminotransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q5E6F2 1.03e-175 495 63 1 360 3 serC Phosphoserine aminotransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FCJ8 6.1e-174 491 63 1 360 3 serC Phosphoserine aminotransferase Aliivibrio fischeri (strain MJ11)
C4K3B1 2.68e-173 489 64 4 367 3 serC Phosphoserine aminotransferase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q1LTL2 7.59e-172 485 62 2 362 3 serC Phosphoserine aminotransferase Baumannia cicadellinicola subsp. Homalodisca coagulata
P81435 1.89e-161 459 56 0 360 3 serC Phosphoserine aminotransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9KSU7 1.54e-160 457 60 1 358 3 serC Phosphoserine aminotransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B8D7K4 2.32e-154 441 55 0 360 3 serC Phosphoserine aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57397 3.33e-154 441 56 0 360 3 serC Phosphoserine aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9A2 3.33e-154 441 56 0 360 3 serC Phosphoserine aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q492S5 1.86e-152 436 54 1 361 3 serC Phosphoserine aminotransferase Blochmanniella pennsylvanica (strain BPEN)
Q0I322 2.86e-149 428 55 1 359 3 serC Phosphoserine aminotransferase Histophilus somni (strain 129Pt)
Q6F961 6.05e-147 422 55 1 358 3 serC Phosphoserine aminotransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q7VLP0 7.02e-147 422 56 1 357 3 serC Phosphoserine aminotransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7VR40 2.95e-146 421 52 3 364 3 serC Phosphoserine aminotransferase Blochmanniella floridana
P59492 3.38e-146 421 52 2 366 3 serC Phosphoserine aminotransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A3M7Z0 3.44e-146 420 55 1 358 3 serC Phosphoserine aminotransferase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B7I5D6 3.44e-146 420 55 1 358 3 serC Phosphoserine aminotransferase Acinetobacter baumannii (strain AB0057)
B7GY87 3.44e-146 420 55 1 358 3 serC Phosphoserine aminotransferase Acinetobacter baumannii (strain AB307-0294)
B2HWW3 3.16e-145 417 55 1 358 3 serC Phosphoserine aminotransferase Acinetobacter baumannii (strain ACICU)
P57881 3.31e-144 415 54 1 360 3 serC Phosphoserine aminotransferase Pasteurella multocida (strain Pm70)
Q3SK88 7.26e-144 414 55 3 359 3 serC Phosphoserine aminotransferase Thiobacillus denitrificans (strain ATCC 25259)
Q5QZ48 1.43e-143 414 55 2 360 3 serC Phosphoserine aminotransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q12MU6 2.41e-143 413 54 4 365 3 serC Phosphoserine aminotransferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q65S80 6.48e-143 412 53 2 362 3 serC Phosphoserine aminotransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P44336 1.08e-142 411 54 1 360 3 serC Phosphoserine aminotransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q2SCF2 4.19e-142 410 55 2 358 3 serC Phosphoserine aminotransferase Hahella chejuensis (strain KCTC 2396)
A0KWN5 8.46e-142 409 54 3 364 3 serC Phosphoserine aminotransferase Shewanella sp. (strain ANA-3)
Q0HIX3 2.55e-141 408 54 3 364 3 serC Phosphoserine aminotransferase Shewanella sp. (strain MR-4)
A4XTE7 5.89e-141 407 53 1 359 3 serC Phosphoserine aminotransferase Pseudomonas mendocina (strain ymp)
Q3ILA3 1.41e-140 406 51 0 357 3 serC Phosphoserine aminotransferase Pseudoalteromonas translucida (strain TAC 125)
Q0HV09 2.55e-140 405 54 3 364 3 serC Phosphoserine aminotransferase Shewanella sp. (strain MR-7)
Q057N5 3.14e-140 405 50 2 361 3 serC Phosphoserine aminotransferase Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q39IG4 2.57e-139 403 53 2 358 3 serC Phosphoserine aminotransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A3D4A1 4.51e-139 402 53 3 364 3 serC Phosphoserine aminotransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B2T637 6.3e-139 402 53 0 357 3 serC Phosphoserine aminotransferase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A1S6D1 8.14e-139 402 54 2 364 3 serC Phosphoserine aminotransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B8EA90 8.49e-139 402 54 3 364 3 serC Phosphoserine aminotransferase Shewanella baltica (strain OS223)
A4JCH1 1.49e-138 401 53 2 358 3 serC Phosphoserine aminotransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q8EEH2 1.95e-138 400 54 3 363 3 serC Phosphoserine aminotransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9L2Y2 2.29e-138 400 53 3 364 3 serC Phosphoserine aminotransferase Shewanella baltica (strain OS195)
B4EB45 4.25e-138 400 52 2 358 3 serC Phosphoserine aminotransferase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A9ADV9 5.47e-138 399 53 2 358 3 serC Phosphoserine aminotransferase Burkholderia multivorans (strain ATCC 17616 / 249)
A6WNN5 8.41e-138 399 53 3 364 3 serC Phosphoserine aminotransferase Shewanella baltica (strain OS185)
A1RJD3 1.75e-137 398 53 3 363 3 serC Phosphoserine aminotransferase Shewanella sp. (strain W3-18-1)
B1JXR6 2.78e-137 397 52 2 358 3 serC Phosphoserine aminotransferase Burkholderia orbicola (strain MC0-3)
A4Y757 3.51e-137 397 53 3 363 3 serC Phosphoserine aminotransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A6T1G7 4.05e-137 397 51 2 363 3 serC Phosphoserine aminotransferase Janthinobacterium sp. (strain Marseille)
B1YV30 4.75e-137 397 53 2 358 3 serC Phosphoserine aminotransferase Burkholderia ambifaria (strain MC40-6)
Q0BH96 4.85e-137 397 53 2 358 3 serC Phosphoserine aminotransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q885T5 9.16e-137 396 53 1 358 3 serC Phosphoserine aminotransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q820S0 9.99e-137 396 53 4 369 3 serC Phosphoserine aminotransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q1BY31 1.18e-136 396 52 2 358 3 serC Phosphoserine aminotransferase Burkholderia orbicola (strain AU 1054)
A0K5L8 1.18e-136 396 52 2 358 3 serC Phosphoserine aminotransferase Burkholderia cenocepacia (strain HI2424)
Q4ZQ94 1.63e-136 395 53 1 358 3 serC Phosphoserine aminotransferase Pseudomonas syringae pv. syringae (strain B728a)
Q02PX3 1.07e-135 394 52 1 358 3 serC Phosphoserine aminotransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V9J9 1.07e-135 394 52 1 358 3 serC Phosphoserine aminotransferase Pseudomonas aeruginosa (strain LESB58)
C1DRQ9 1.19e-135 394 52 1 358 3 serC Phosphoserine aminotransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
C1D8N3 1.23e-135 393 54 3 358 3 serC Phosphoserine aminotransferase Laribacter hongkongensis (strain HLHK9)
B2JF00 1.69e-135 393 52 0 357 3 serC Phosphoserine aminotransferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q9HZ66 2.03e-135 393 52 1 358 1 serC Phosphoserine aminotransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1IDA2 8.87e-135 391 51 1 359 3 serC Phosphoserine aminotransferase Pseudomonas entomophila (strain L48)
B0TT41 2.95e-134 390 51 3 366 3 serC Phosphoserine aminotransferase Shewanella halifaxensis (strain HAW-EB4)
Q88M07 3.25e-134 390 51 1 358 3 serC Phosphoserine aminotransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9RI02 4.61e-134 389 51 1 358 3 serC Phosphoserine aminotransferase Stutzerimonas stutzeri
A4G865 8.24e-134 389 50 2 363 3 serC Phosphoserine aminotransferase Herminiimonas arsenicoxydans
A6V2Q8 1.63e-133 388 52 1 355 3 serC Phosphoserine aminotransferase Pseudomonas aeruginosa (strain PA7)
A8FVN8 4.53e-133 387 52 2 364 3 serC Phosphoserine aminotransferase Shewanella sediminis (strain HAW-EB3)
Q081U0 6e-133 387 53 3 364 3 serC Phosphoserine aminotransferase Shewanella frigidimarina (strain NCIMB 400)
A8H4A2 1.67e-132 385 52 4 368 3 serC Phosphoserine aminotransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
C3K6J5 1.9e-132 385 51 1 358 3 serC Phosphoserine aminotransferase Pseudomonas fluorescens (strain SBW25)
B2FKF0 3.79e-132 384 51 2 361 1 serC Phosphoserine aminotransferase Stenotrophomonas maltophilia (strain K279a)
B1KF45 6.01e-132 384 52 4 365 3 serC Phosphoserine aminotransferase Shewanella woodyi (strain ATCC 51908 / MS32)
B5EPR5 9.07e-132 384 53 2 358 3 serC Phosphoserine aminotransferase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J6V1 9.07e-132 384 53 2 358 3 serC Phosphoserine aminotransferase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q8Y0Z0 1.33e-131 384 52 3 363 3 serC Phosphoserine aminotransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B4SP45 4.08e-131 382 51 2 361 3 serC Phosphoserine aminotransferase Stenotrophomonas maltophilia (strain R551-3)
Q8D268 8.67e-131 381 46 2 361 3 serC Phosphoserine aminotransferase Wigglesworthia glossinidia brevipalpis
A5CWI0 8.83e-130 379 49 3 363 3 serC Phosphoserine aminotransferase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B2U882 6.21e-129 377 51 3 363 3 serC Phosphoserine aminotransferase Ralstonia pickettii (strain 12J)
B8CMG9 6.61e-129 376 51 2 364 3 serC Phosphoserine aminotransferase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q9SHP0 8.82e-129 378 51 3 362 1 PSAT2 Phosphoserine aminotransferase 2, chloroplastic Arabidopsis thaliana
Q5P7U7 1.29e-128 376 52 4 367 3 serC Phosphoserine aminotransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A1AWS0 1.47e-127 373 49 3 363 3 serC Phosphoserine aminotransferase Ruthia magnifica subsp. Calyptogena magnifica
Q96255 2.85e-127 375 50 2 360 1 PSAT1 Phosphoserine aminotransferase 1, chloroplastic Arabidopsis thaliana
Q7NVP1 3.73e-127 372 51 3 362 3 serC Phosphoserine aminotransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q21Y51 1.19e-125 368 49 3 371 3 serC Phosphoserine aminotransferase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A6VZ92 2.31e-123 362 50 2 360 3 serC Phosphoserine aminotransferase Marinomonas sp. (strain MWYL1)
B2SJJ1 3.74e-123 362 48 2 361 3 serC Phosphoserine aminotransferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q3BUZ3 4.45e-123 362 48 2 361 3 serC Phosphoserine aminotransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PLY7 4.45e-123 362 48 2 361 3 serC Phosphoserine aminotransferase Xanthomonas axonopodis pv. citri (strain 306)
Q5H079 8.11e-123 361 48 2 361 3 serC Phosphoserine aminotransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P354 8.11e-123 361 48 2 361 3 serC Phosphoserine aminotransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B6J1E0 1.08e-122 360 49 3 361 3 serC Phosphoserine aminotransferase Coxiella burnetii (strain CbuG_Q212)
A1VR16 1.17e-122 361 47 4 370 3 serC Phosphoserine aminotransferase Polaromonas naphthalenivorans (strain CJ2)
A9KCT6 1.56e-122 360 49 3 361 3 serC Phosphoserine aminotransferase Coxiella burnetii (strain Dugway 5J108-111)
Q83E12 7.82e-122 358 49 3 361 3 serC Phosphoserine aminotransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
B6J893 1.16e-121 358 49 3 361 3 serC Phosphoserine aminotransferase Coxiella burnetii (strain CbuK_Q154)
A9BM04 3.82e-121 357 48 4 370 3 serC Phosphoserine aminotransferase Delftia acidovorans (strain DSM 14801 / SPH-1)
Q12CL3 5.59e-121 356 47 4 370 3 serC Phosphoserine aminotransferase Polaromonas sp. (strain JS666 / ATCC BAA-500)
A9NC17 7.62e-121 356 48 3 361 3 serC Phosphoserine aminotransferase Coxiella burnetii (strain RSA 331 / Henzerling II)
B0RUW3 1.75e-120 355 47 3 363 3 serC Phosphoserine aminotransferase Xanthomonas campestris pv. campestris (strain B100)
Q8PA97 2.1e-120 355 47 3 363 3 serC Phosphoserine aminotransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UTC9 2.1e-120 355 47 3 363 3 serC Phosphoserine aminotransferase Xanthomonas campestris pv. campestris (strain 8004)
A1TSA3 9e-120 353 48 6 370 3 serC Phosphoserine aminotransferase Paracidovorax citrulli (strain AAC00-1)
Q87BU0 1.12e-117 348 50 4 361 3 serC Phosphoserine aminotransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PB19 2.06e-117 347 49 3 361 3 serC Phosphoserine aminotransferase Xylella fastidiosa (strain 9a5c)
P57007 3.67e-117 347 48 3 362 3 serC Phosphoserine aminotransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q5F7A0 3.96e-117 347 48 3 362 3 serC Phosphoserine aminotransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
P10658 1.39e-116 345 46 4 365 2 PSAT1 Phosphoserine aminotransferase Oryctolagus cuniculus
Q99K85 1.74e-116 345 46 4 365 1 Psat1 Phosphoserine aminotransferase Mus musculus
O34370 2.03e-116 345 48 3 362 3 serC Phosphoserine aminotransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q71VT6 3.07e-116 344 50 4 356 3 serC Phosphoserine aminotransferase Listeria monocytogenes serotype 4b (strain F2365)
Q8Y3L0 3.89e-116 344 50 4 356 3 serC Phosphoserine aminotransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
A1KV48 4.54e-116 344 48 3 362 3 serC Phosphoserine aminotransferase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q2L2T1 7.27e-116 343 47 5 375 3 serC Phosphoserine aminotransferase Bordetella avium (strain 197N)
Q81BC0 1.14e-115 343 46 2 358 3 serC Phosphoserine aminotransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9Y617 3.37e-115 342 47 4 365 1 PSAT1 Phosphoserine aminotransferase Homo sapiens
B1HSU6 1.14e-114 340 45 2 359 3 serC Phosphoserine aminotransferase Lysinibacillus sphaericus (strain C3-41)
Q926T3 5.01e-114 338 49 4 356 3 serC Phosphoserine aminotransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A9IJI3 7.84e-114 338 46 4 375 3 serC Phosphoserine aminotransferase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
P52877 1.26e-113 340 47 4 369 1 PSA Phosphoserine aminotransferase, chloroplastic Spinacia oleracea
Q7VZG4 1.44e-113 338 46 3 375 3 serC Phosphoserine aminotransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A9B6Q3 1.95e-113 337 46 2 358 3 serC Phosphoserine aminotransferase Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q7W5Z9 2.77e-113 337 46 3 375 3 serC Phosphoserine aminotransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WGU2 2.77e-113 337 46 3 375 3 serC Phosphoserine aminotransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q734W9 2.49e-112 334 46 3 358 3 serC Phosphoserine aminotransferase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q638W1 2.9e-112 334 45 1 357 3 serC Phosphoserine aminotransferase Bacillus cereus (strain ZK / E33L)
Q6HGI0 1.58e-111 332 45 1 357 3 serC Phosphoserine aminotransferase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6ALW3 2.22e-111 332 47 3 360 3 serC Phosphoserine aminotransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
C3P210 1.6e-109 327 45 1 357 3 serC Phosphoserine aminotransferase Bacillus anthracis (strain A0248)
Q9CHW5 4.07e-109 326 47 7 362 3 serC Phosphoserine aminotransferase Lactococcus lactis subsp. lactis (strain IL1403)
Q031D5 1.45e-108 325 47 7 365 3 serC Phosphoserine aminotransferase Lactococcus lactis subsp. cremoris (strain SK11)
A2RIS2 2.06e-108 324 47 8 368 3 serC Phosphoserine aminotransferase Lactococcus lactis subsp. cremoris (strain MG1363)
Q88ZU5 2.36e-107 321 45 3 357 3 serC Phosphoserine aminotransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9VAN0 2.99e-107 321 44 5 360 2 CG11899 Probable phosphoserine aminotransferase Drosophila melanogaster
A5IBR0 4.62e-107 321 44 2 356 3 serC Phosphoserine aminotransferase Legionella pneumophila (strain Corby)
Q5X5E7 8.14e-107 320 43 2 356 3 serC Phosphoserine aminotransferase Legionella pneumophila (strain Paris)
Q9RME2 8.69e-107 320 43 2 358 1 serC Phosphoserine aminotransferase Alkalihalobacillus alcalophilus
Q59196 2.07e-106 319 43 2 356 1 serC Phosphoserine aminotransferase Niallia circulans
A3CPJ2 2.21e-106 319 46 4 363 3 serC Phosphoserine aminotransferase Streptococcus sanguinis (strain SK36)
Q5L296 2.69e-106 319 46 3 360 3 serC Phosphoserine aminotransferase Geobacillus kaustophilus (strain HTA426)
Q8F930 2.94e-106 319 45 1 357 3 serC Phosphoserine aminotransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72VI2 2.94e-106 319 45 1 357 3 serC Phosphoserine aminotransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q1D2L9 4.34e-106 318 47 3 357 3 serC Phosphoserine aminotransferase Myxococcus xanthus (strain DK1622)
Q8DSV3 5.11e-106 318 45 4 362 3 serC Phosphoserine aminotransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q5ZVM2 6.15e-106 318 44 2 356 3 serC Phosphoserine aminotransferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5WWT0 1.44e-105 317 44 2 356 3 serC Phosphoserine aminotransferase Legionella pneumophila (strain Lens)
A4VU42 1.84e-105 317 46 5 358 3 serC Phosphoserine aminotransferase Streptococcus suis (strain 05ZYH33)
A4W0D4 1.84e-105 317 46 5 358 3 serC Phosphoserine aminotransferase Streptococcus suis (strain 98HAH33)
A8YW78 3.38e-105 317 42 1 357 3 serC Phosphoserine aminotransferase Lactobacillus helveticus (strain DPC 4571)
Q03JH6 8.82e-105 315 46 6 363 3 serC Phosphoserine aminotransferase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5LYP0 8.82e-105 315 46 6 363 3 serC Phosphoserine aminotransferase Streptococcus thermophilus (strain CNRZ 1066)
B9DTW4 1.02e-104 315 45 4 363 3 serC Phosphoserine aminotransferase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B8FLC3 4.13e-104 313 45 2 360 3 serC Phosphoserine aminotransferase Desulfatibacillum aliphaticivorans
A9A0A5 6.18e-104 313 45 2 356 3 serC Phosphoserine aminotransferase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q5M3A4 1.64e-103 312 45 6 363 3 serC Phosphoserine aminotransferase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q55CQ6 1.1e-102 310 42 6 366 3 serC Probable phosphoserine aminotransferase Dictyostelium discoideum
Q9KDM4 3.26e-102 308 43 2 361 3 serC Phosphoserine aminotransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P91856 4.03e-102 308 43 4 362 3 F26H9.5 Probable phosphoserine aminotransferase Caenorhabditis elegans
Q5WHT9 1.2e-100 305 44 5 364 3 serC Phosphoserine aminotransferase Shouchella clausii (strain KSM-K16)
B0SKW4 3.67e-100 303 43 2 356 3 serC Phosphoserine aminotransferase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SCE2 3.67e-100 303 43 2 356 3 serC Phosphoserine aminotransferase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q7UQL3 6.75e-100 303 46 5 363 3 serC Phosphoserine aminotransferase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8E3Y3 3.92e-99 300 43 5 363 3 serC Phosphoserine aminotransferase Streptococcus agalactiae serotype III (strain NEM316)
A0LK14 6.19e-97 295 44 3 355 3 serC Phosphoserine aminotransferase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
P80862 1.04e-93 286 41 3 361 1 serC Phosphoserine aminotransferase Bacillus subtilis (strain 168)
Q7MV30 3.09e-93 285 41 4 360 3 serC Phosphoserine aminotransferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RID6 3.09e-93 285 41 4 360 3 serC Phosphoserine aminotransferase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
B2GBS2 6.7e-93 285 42 5 356 3 serC Phosphoserine aminotransferase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
B6YQL2 1.98e-92 283 41 5 358 3 serC Phosphoserine aminotransferase Azobacteroides pseudotrichonymphae genomovar. CFP2
A6L9B7 4.44e-90 277 40 4 358 3 serC Phosphoserine aminotransferase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
C4L432 3.14e-88 273 41 5 354 3 serC Phosphoserine aminotransferase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A7H543 1.71e-87 271 39 7 359 3 serC Phosphoserine aminotransferase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q9PIH3 1.91e-87 270 39 7 359 1 serC Phosphoserine aminotransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q8A8L4 2.57e-87 270 39 6 359 3 serC Phosphoserine aminotransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A1VY45 5e-87 270 38 7 359 3 serC Phosphoserine aminotransferase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q5HWE5 1.31e-86 268 39 7 359 3 serC Phosphoserine aminotransferase Campylobacter jejuni (strain RM1221)
A5FH28 2.31e-86 268 40 4 356 3 serC Phosphoserine aminotransferase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
A8FKB5 4.6e-86 267 39 7 359 3 serC Phosphoserine aminotransferase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B9KDM7 1.43e-85 266 39 7 363 3 serC Phosphoserine aminotransferase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q64UR4 1.46e-85 266 39 5 358 3 serC Phosphoserine aminotransferase Bacteroides fragilis (strain YCH46)
Q5LDN9 1.46e-85 266 39 5 358 3 serC Phosphoserine aminotransferase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A6L5A6 8.69e-84 261 40 6 359 3 serC Phosphoserine aminotransferase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A6GXC2 1.03e-82 258 39 4 356 3 serC Phosphoserine aminotransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
A5EV80 1.63e-79 250 37 4 359 3 serC Phosphoserine aminotransferase Dichelobacter nodosus (strain VCS1703A)
P33330 2.15e-74 238 37 8 386 1 SER1 Phosphoserine aminotransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q10349 1.63e-73 236 33 5 383 3 SPAC1F12.07 Putative phosphoserine aminotransferase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q03W65 8.78e-73 233 37 5 360 3 serC Phosphoserine aminotransferase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
A1TF55 3.59e-19 90 28 13 326 3 serC Putative phosphoserine aminotransferase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q1B3G6 2.16e-16 82 24 12 339 3 serC Putative phosphoserine aminotransferase Mycobacterium sp. (strain MCS)
A1ULN4 2.16e-16 82 24 12 339 3 serC Putative phosphoserine aminotransferase Mycobacterium sp. (strain KMS)
A3Q635 2.16e-16 82 24 12 339 3 serC Putative phosphoserine aminotransferase Mycobacterium sp. (strain JLS)
O33062 2.21e-14 77 24 14 361 3 serC Putative phosphoserine aminotransferase Mycobacterium leprae (strain TN)
A0QBI3 2.83e-14 76 26 8 263 3 serC Putative phosphoserine aminotransferase Mycobacterium avium (strain 104)
Q742L2 4.47e-14 76 26 8 263 3 serC Putative phosphoserine aminotransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WQ73 1.03e-12 72 23 15 376 1 serC Phosphoserine aminotransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ72 1.03e-12 72 23 15 376 3 serC Phosphoserine aminotransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63515 1.03e-12 72 23 15 376 3 serC Putative phosphoserine aminotransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
C1ATN6 6.85e-10 63 23 15 364 3 serC Phosphoserine aminotransferase Rhodococcus opacus (strain B4)
Q0S6R3 3.02e-09 61 23 15 364 3 serC Phosphoserine aminotransferase Rhodococcus jostii (strain RHA1)
Q9X1C0 4.51e-05 48 24 7 224 1 TM_1400 Serine-pyruvate aminotransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A1SEM0 5.14e-05 48 21 9 334 3 serC Phosphoserine aminotransferase Nocardioides sp. (strain ATCC BAA-499 / JS614)
A4QCG9 0.000378 45 22 14 335 3 serC Phosphoserine aminotransferase Corynebacterium glutamicum (strain R)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_03825
Feature type CDS
Gene serC
Product 3-phosphoserine/phosphohydroxythreonine transaminase
Location 84359 - 85444 (strand: -1)
Length 1086 (nucleotides) / 361 (amino acids)

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1226
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00266 Aminotransferase class-V

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1932 Coenzyme transport and metabolism (H)
Amino acid transport and metabolism (E)
HE Phosphoserine aminotransferase

Kegg Ortholog Annotation(s)

Protein Sequence

MSQVYNFSAGPAMLPVEVLRRAEQELCNWRGLGTSVMEISHRSKEFMSVAKEAENNLRQILAVPDNYKVLFCHGGARGHFAALPMNLLGDKTKADYVVGGYWAECAAEEAKKYCTPNIINVRTESEDGIGVKPMSEWQLSDDAAYVHYCPNETIDGIAIHEEPDFGDKIVIADYSSAILSKPLDVSRFGVIYAGAQKNIGPAGLTLVIIREDLLGKARRETPSILDYTVLSECDSMFNTPPTFAWYLSGMVFKWLIEQGGLQEIARINYDKAQLLYSAVDHSDFYINRVAAANRSLMNVPFQMSDPSLDSKFLAEAQAQGLVSLKGHKVAGGMRASIYNAMPYEGVRALAEFMAEFESRHS

Flanking regions ( +/- flanking 50bp)

ATTCATATGATGGATATACAGGGCATTAATTTACAGATAGGGTGAGGTCAATGAGTCAGGTATATAACTTTAGTGCCGGTCCGGCTATGCTGCCGGTAGAAGTGCTGCGCCGTGCTGAGCAGGAACTGTGCAACTGGCGCGGGCTCGGCACCTCAGTCATGGAAATCAGTCACCGCAGCAAAGAGTTTATGTCGGTGGCAAAGGAAGCGGAAAATAATCTGCGCCAGATCCTCGCGGTACCGGATAACTATAAAGTACTGTTTTGCCACGGCGGCGCACGCGGACATTTTGCCGCACTGCCGATGAACCTGCTGGGTGATAAAACCAAAGCGGATTATGTGGTGGGCGGATACTGGGCGGAATGTGCGGCAGAAGAAGCAAAAAAATATTGCACACCGAACATTATTAATGTCAGAACCGAATCGGAAGACGGTATCGGCGTGAAACCGATGAGCGAATGGCAGCTCAGTGATGATGCAGCCTATGTTCACTACTGCCCGAATGAAACCATTGATGGTATCGCTATCCATGAAGAGCCGGATTTCGGCGATAAAATCGTGATTGCGGATTACTCCTCGGCCATCCTGTCCAAACCGCTGGATGTCAGCCGTTTCGGGGTGATTTATGCGGGCGCGCAGAAAAATATCGGCCCGGCCGGGCTGACCCTGGTGATTATCCGTGAGGATCTGCTGGGCAAAGCTCGCAGAGAAACCCCGTCCATCCTCGACTACACCGTACTGAGTGAATGTGACTCCATGTTCAACACCCCGCCGACCTTTGCCTGGTATCTCTCCGGTATGGTCTTTAAGTGGCTGATTGAACAGGGTGGTTTACAGGAAATCGCCCGGATCAACTATGATAAAGCACAACTGCTTTATTCAGCGGTGGATCACAGTGATTTCTATATTAACCGTGTGGCGGCGGCCAACCGTTCCCTGATGAACGTGCCGTTCCAGATGTCTGATCCGTCACTGGACAGCAAATTCCTCGCCGAAGCACAGGCACAGGGACTGGTCTCCCTGAAAGGGCACAAAGTCGCCGGCGGGATGCGCGCCTCCATTTATAATGCGATGCCGTATGAAGGCGTGCGCGCACTGGCCGAATTTATGGCGGAGTTTGAAAGCCGTCACAGCTGATTTTTTGCAGACATTTTTCCGGGACCGGGTAAGCATCCGGCCCCGTTTTT