Homologs in group_288

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06920 FBDBKF_06920 67.9 Morganella morganii S1 hisC histidinol-phosphate transaminase
EHELCC_04050 EHELCC_04050 67.9 Morganella morganii S2 hisC histidinol-phosphate transaminase
NLDBIP_04050 NLDBIP_04050 67.9 Morganella morganii S4 hisC histidinol-phosphate transaminase
LHKJJB_09880 LHKJJB_09880 67.9 Morganella morganii S3 hisC histidinol-phosphate transaminase
HKOGLL_09095 HKOGLL_09095 67.9 Morganella morganii S5 hisC histidinol-phosphate transaminase
F4V73_RS01105 F4V73_RS01105 65.9 Morganella psychrotolerans hisC histidinol-phosphate transaminase
PMI_RS14095 PMI_RS14095 23.4 Proteus mirabilis HI4320 - valine--pyruvate transaminase

Distribution of the homologs in the orthogroup group_288

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_288

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A7FJH1 0.0 525 70 0 352 3 hisC Histidinol-phosphate aminotransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7N6I1 0.0 525 68 0 359 3 hisCD Putative histidine biosynthesis bifunctional protein HisCD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JPW1 0.0 523 70 0 352 3 hisC Histidinol-phosphate aminotransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66C50 0.0 523 70 0 352 3 hisC Histidinol-phosphate aminotransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2JZM8 0.0 523 70 0 352 3 hisC Histidinol-phosphate aminotransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A4TKK4 0.0 521 69 0 352 3 hisC Histidinol-phosphate aminotransferase Yersinia pestis (strain Pestoides F)
Q1CGX0 0.0 521 69 0 352 3 hisC Histidinol-phosphate aminotransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R2K5 0.0 521 69 0 352 3 hisC Histidinol-phosphate aminotransferase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZFX6 0.0 521 69 0 352 3 hisC Histidinol-phosphate aminotransferase Yersinia pestis
Q1C9R1 0.0 521 69 0 352 3 hisC Histidinol-phosphate aminotransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A8GC78 0.0 514 69 0 349 3 hisC Histidinol-phosphate aminotransferase Serratia proteamaculans (strain 568)
Q6D410 0.0 514 69 0 349 3 hisC Histidinol-phosphate aminotransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7ZNJ3 0.0 513 70 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7MDH5 0.0 512 70 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
A1JTV9 0.0 512 68 0 352 3 hisC Histidinol-phosphate aminotransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B7LUF2 0.0 511 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1IZ53 0.0 511 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7L9P8 0.0 511 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli (strain 55989 / EAEC)
B7NQG9 0.0 511 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YU77 0.0 511 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q9S5G6 0.0 511 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O157:H7
B6I848 0.0 510 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli (strain SE11)
P06986 0.0 510 69 0 350 1 hisC Histidinol-phosphate aminotransferase Escherichia coli (strain K12)
B1X6V8 0.0 510 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli (strain K12 / DH10B)
C4ZSB0 0.0 510 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M400 0.0 510 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O8 (strain IAI1)
Q1RA52 0.0 510 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli (strain UTI89 / UPEC)
Q8FG51 0.0 510 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TG66 0.0 510 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B2TYF9 0.0 509 69 0 350 3 hisC Histidinol-phosphate aminotransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7MWU0 0.0 509 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O81 (strain ED1a)
B1LP20 0.0 508 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli (strain SMS-3-5 / SECEC)
Q3Z0G4 0.0 508 69 0 350 3 hisC Histidinol-phosphate aminotransferase Shigella sonnei (strain Ss046)
Q83KJ6 0.0 508 69 0 350 3 hisC Histidinol-phosphate aminotransferase Shigella flexneri
Q0T3A6 0.0 508 69 0 350 3 hisC Histidinol-phosphate aminotransferase Shigella flexneri serotype 5b (strain 8401)
C6DF75 0.0 508 68 0 349 3 hisC Histidinol-phosphate aminotransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B7UT58 0.0 508 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A8A1P5 0.0 508 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O9:H4 (strain HS)
A1ACN3 2.48e-180 506 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O1:K1 / APEC
A4WC70 4.15e-180 506 69 0 352 3 hisC Histidinol-phosphate aminotransferase Enterobacter sp. (strain 638)
Q32EF0 2.26e-179 504 69 0 350 3 hisC Histidinol-phosphate aminotransferase Shigella dysenteriae serotype 1 (strain Sd197)
Q323J1 3.43e-179 504 68 0 350 3 hisC Histidinol-phosphate aminotransferase Shigella boydii serotype 4 (strain Sb227)
B7NC61 6.54e-179 503 69 0 350 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B5FM42 1.5e-178 502 68 0 344 3 hisC Histidinol-phosphate aminotransferase Salmonella dublin (strain CT_02021853)
A8AEK3 2.51e-178 501 67 0 351 3 hisC Histidinol-phosphate aminotransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B4TMR6 3.02e-178 501 68 0 344 3 hisC Histidinol-phosphate aminotransferase Salmonella schwarzengrund (strain CVM19633)
B5RBR3 3.02e-178 501 68 0 344 3 hisC Histidinol-phosphate aminotransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZL3 3.02e-178 501 68 0 344 3 hisC Histidinol-phosphate aminotransferase Salmonella enteritidis PT4 (strain P125109)
B5EX40 3.02e-178 501 68 0 344 3 hisC Histidinol-phosphate aminotransferase Salmonella agona (strain SL483)
B4T9N5 3.19e-178 501 69 0 344 3 hisC Histidinol-phosphate aminotransferase Salmonella heidelberg (strain SL476)
Q57MS2 3.34e-178 501 68 0 344 3 hisC Histidinol-phosphate aminotransferase Salmonella choleraesuis (strain SC-B67)
A9MSC2 3.97e-178 501 68 0 344 3 hisC Histidinol-phosphate aminotransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SX42 3.97e-178 501 68 0 344 3 hisC Histidinol-phosphate aminotransferase Salmonella newport (strain SL254)
C0Q1K1 6.94e-178 500 68 0 344 3 hisC Histidinol-phosphate aminotransferase Salmonella paratyphi C (strain RKS4594)
P10369 1.17e-177 500 68 0 344 3 hisC Histidinol-phosphate aminotransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BFB9 1.96e-177 499 68 0 344 3 hisC Histidinol-phosphate aminotransferase Salmonella paratyphi A (strain AKU_12601)
Q5PDP4 1.96e-177 499 68 0 344 3 hisC Histidinol-phosphate aminotransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A7MJP4 6.08e-177 498 68 0 351 3 hisC Histidinol-phosphate aminotransferase Cronobacter sakazakii (strain ATCC BAA-894)
Q8Z5J9 7.22e-177 498 68 0 344 3 hisC Histidinol-phosphate aminotransferase Salmonella typhi
B5XPE6 1.69e-174 491 67 0 348 3 hisC Histidinol-phosphate aminotransferase Klebsiella pneumoniae (strain 342)
A6TBC4 1.97e-174 491 67 0 348 1 hisC Histidinol-phosphate aminotransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A9ML15 1.13e-173 490 67 0 344 3 hisC Histidinol-phosphate aminotransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q2NTX2 1.21e-164 467 64 0 349 3 hisC Histidinol-phosphate aminotransferase Sodalis glossinidius (strain morsitans)
Q9CLM3 2.42e-153 438 59 1 349 3 hisC1 Histidinol-phosphate aminotransferase 1 Pasteurella multocida (strain Pm70)
Q65RB2 2.65e-152 435 58 1 349 3 hisC2 Histidinol-phosphate aminotransferase 2 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q492K2 1.74e-149 428 55 0 356 3 hisC Histidinol-phosphate aminotransferase Blochmanniella pennsylvanica (strain BPEN)
P44423 5.17e-149 427 56 0 351 3 hisC1 Histidinol-phosphate aminotransferase 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UGY2 7.84e-149 426 57 0 347 3 hisC Histidinol-phosphate aminotransferase Haemophilus influenzae (strain PittGG)
Q4QN73 1.53e-148 426 57 0 347 3 hisC1 Histidinol-phosphate aminotransferase 1 Haemophilus influenzae (strain 86-028NP)
A5UA19 2.07e-148 426 57 0 347 3 hisC Histidinol-phosphate aminotransferase Haemophilus influenzae (strain PittEE)
Q1LT68 1.98e-147 423 60 1 340 3 hisC Histidinol-phosphate aminotransferase Baumannia cicadellinicola subsp. Homalodisca coagulata
B5FDA0 1.47e-146 421 58 2 346 3 hisC Histidinol-phosphate aminotransferase Aliivibrio fischeri (strain MJ11)
Q5E637 6.8e-145 416 58 2 346 3 hisC Histidinol-phosphate aminotransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7VQW9 6.86e-145 417 55 0 349 3 hisC Histidinol-phosphate aminotransferase Blochmanniella floridana
Q87QL0 8.74e-145 416 58 2 345 3 hisC Histidinol-phosphate aminotransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MX17 3.14e-144 415 58 2 345 3 hisC Histidinol-phosphate aminotransferase Vibrio campbellii (strain ATCC BAA-1116)
C3LU31 2.68e-142 410 57 2 345 3 hisC Histidinol-phosphate aminotransferase Vibrio cholerae serotype O1 (strain M66-2)
A5F2A2 2.68e-142 410 57 2 345 3 hisC Histidinol-phosphate aminotransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KSX2 1.11e-141 408 57 2 345 3 hisC Histidinol-phosphate aminotransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B6EJ89 3.98e-141 407 56 2 346 3 hisC Histidinol-phosphate aminotransferase Aliivibrio salmonicida (strain LFI1238)
Q9ZHE5 1.11e-139 403 54 1 350 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q6LT75 1.12e-139 404 56 2 354 3 hisC Histidinol-phosphate aminotransferase Photobacterium profundum (strain SS9)
Q7MLS5 1.14e-135 393 57 2 345 3 hisC Histidinol-phosphate aminotransferase Vibrio vulnificus (strain YJ016)
Q8D8Q1 1.04e-134 390 57 2 345 3 hisC Histidinol-phosphate aminotransferase Vibrio vulnificus (strain CMCP6)
A4SMP7 1.07e-134 391 55 0 351 3 hisC Histidinol-phosphate aminotransferase Aeromonas salmonicida (strain A449)
A0KKB7 7.86e-134 389 55 0 350 3 hisC Histidinol-phosphate aminotransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q84I53 6.53e-133 387 51 2 346 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Diuraphis noxia
Q89AX7 2.06e-130 380 50 0 345 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q84I51 4.01e-130 379 52 4 354 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Schlechtendalia chinensis
B8D707 1.83e-129 378 51 2 350 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D8Q3 1.83e-129 378 51 2 350 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
P57202 2.65e-129 377 51 2 350 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q84I52 2.28e-123 362 48 2 351 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Melaphis rhois
Q15RU8 2.02e-120 355 52 1 350 3 hisC Histidinol-phosphate aminotransferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q5QWQ9 4.95e-111 331 48 3 350 3 hisC2 Histidinol-phosphate aminotransferase 2 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q058A6 6.14e-106 318 44 0 340 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q8EFB2 3.14e-97 296 44 6 358 3 hisC Histidinol-phosphate aminotransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q47XB7 7.76e-93 285 42 5 357 3 hisC Histidinol-phosphate aminotransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q3BUF6 1.76e-85 266 41 5 359 3 hisC Histidinol-phosphate aminotransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P58891 4.18e-85 265 42 5 359 3 hisC Histidinol-phosphate aminotransferase Xanthomonas axonopodis pv. citri (strain 306)
Q5H0L0 5.09e-84 262 41 5 362 3 hisC Histidinol-phosphate aminotransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P3K2 5.09e-84 262 41 5 362 3 hisC Histidinol-phosphate aminotransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q87C30 1.15e-83 261 40 4 354 3 hisC Histidinol-phosphate aminotransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I5Y0 1.15e-83 261 40 4 354 3 hisC Histidinol-phosphate aminotransferase Xylella fastidiosa (strain M23)
B0U3B2 1.31e-83 261 40 4 354 3 hisC Histidinol-phosphate aminotransferase Xylella fastidiosa (strain M12)
Q9PBC6 1.43e-83 261 40 4 362 3 hisC Histidinol-phosphate aminotransferase Xylella fastidiosa (strain 9a5c)
B2FPM0 1.84e-81 255 40 5 357 3 hisC Histidinol-phosphate aminotransferase Stenotrophomonas maltophilia (strain K279a)
Q4UU41 2.42e-81 255 42 5 358 3 hisC Histidinol-phosphate aminotransferase Xanthomonas campestris pv. campestris (strain 8004)
B4STN8 2.83e-81 255 41 6 357 3 hisC Histidinol-phosphate aminotransferase Stenotrophomonas maltophilia (strain R551-3)
B0RSL5 1.31e-80 253 41 5 358 3 hisC Histidinol-phosphate aminotransferase Xanthomonas campestris pv. campestris (strain B100)
P58892 3.31e-80 252 41 5 358 3 hisC Histidinol-phosphate aminotransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
A5FFY0 5.55e-80 251 40 7 359 3 hisC Histidinol-phosphate aminotransferase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
A0M287 7.48e-79 248 38 5 353 3 hisC Histidinol-phosphate aminotransferase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A6LAM2 3.11e-77 244 39 5 353 3 hisC Histidinol-phosphate aminotransferase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A1S6Z2 4.96e-76 241 45 9 355 3 hisC Histidinol-phosphate aminotransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A6GY79 7.74e-76 240 37 6 354 3 hisC Histidinol-phosphate aminotransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
B0TY45 9.31e-76 241 35 4 347 3 hisC Histidinol-phosphate aminotransferase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q11VM5 1.29e-71 229 36 5 351 3 hisC Histidinol-phosphate aminotransferase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A6L2V8 1.53e-65 214 36 6 354 3 hisC Histidinol-phosphate aminotransferase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q64RE8 1.57e-64 211 37 8 352 3 hisC Histidinol-phosphate aminotransferase Bacteroides fragilis (strain YCH46)
Q5LAZ9 1.8e-64 211 37 8 352 3 hisC Histidinol-phosphate aminotransferase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q8ABA8 4.89e-62 205 36 7 357 3 hisC Histidinol-phosphate aminotransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B0K625 5.91e-60 199 37 6 303 3 hisC Histidinol-phosphate aminotransferase Thermoanaerobacter sp. (strain X514)
B0K735 5.97e-60 199 37 6 303 3 hisC Histidinol-phosphate aminotransferase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q5X5X0 9.25e-59 197 35 5 325 3 hisC1 Histidinol-phosphate aminotransferase 1 Legionella pneumophila (strain Paris)
Q5ZW88 1.52e-57 194 35 7 330 3 hisC1 Histidinol-phosphate aminotransferase 1 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5WX92 1.88e-57 193 34 5 325 3 hisC1 Histidinol-phosphate aminotransferase 1 Legionella pneumophila (strain Lens)
P36605 3.17e-57 193 32 7 374 3 his3 Histidinol-phosphate aminotransferase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P56099 2.08e-55 189 33 13 377 3 HIS5 Histidinol-phosphate aminotransferase Candida maltosa
P07172 4.42e-55 188 32 12 377 1 HIS5 Histidinol-phosphate aminotransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8R5Q4 2.78e-54 185 34 6 304 1 hisC Histidinol-phosphate aminotransferase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A5CZ78 5.7e-54 184 38 9 323 3 hisC Histidinol-phosphate aminotransferase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q8TH25 1.52e-51 177 33 10 345 3 hisC Histidinol-phosphate aminotransferase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
B8I5V1 9.5e-51 176 33 11 358 3 hisC Histidinol-phosphate aminotransferase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q3ARM7 1.84e-50 175 32 9 354 3 hisC Histidinol-phosphate aminotransferase Chlorobium chlorochromatii (strain CaD3)
C5A7A4 2.61e-49 171 31 11 347 3 hisC Histidinol-phosphate aminotransferase Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
Q5JFU6 7.93e-47 165 33 11 352 3 hisC Histidinol-phosphate aminotransferase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
B4SGL8 1.1e-46 165 33 9 336 3 hisC Histidinol-phosphate aminotransferase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A5N7Q7 1.22e-46 165 30 11 352 3 hisC Histidinol-phosphate aminotransferase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E168 1.22e-46 165 30 11 352 3 hisC Histidinol-phosphate aminotransferase Clostridium kluyveri (strain NBRC 12016)
Q8KD01 2.89e-45 161 32 8 336 3 hisC Histidinol-phosphate aminotransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B3ECG2 1.13e-44 160 32 8 338 3 hisC Histidinol-phosphate aminotransferase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q4QLD1 5.13e-44 158 32 15 366 3 hisC2 Histidinol-phosphate aminotransferase 2 Haemophilus influenzae (strain 86-028NP)
A4SE60 6.97e-44 158 32 7 335 3 hisC Histidinol-phosphate aminotransferase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q57004 7.41e-44 158 31 12 363 3 hisC2 Histidinol-phosphate aminotransferase 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0DI07 8.02e-44 159 33 11 361 1 HISN6B Histidinol-phosphate aminotransferase 2, chloroplastic Arabidopsis thaliana
B9DHD3 8.02e-44 159 33 11 361 1 HISN6A Histidinol-phosphate aminotransferase 1, chloroplastic Arabidopsis thaliana
B4S8L6 1.54e-43 157 30 7 336 3 hisC Histidinol-phosphate aminotransferase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B3DXN2 1.73e-43 157 32 10 352 3 hisC Histidinol-phosphate aminotransferase Methylacidiphilum infernorum (isolate V4)
A5V022 1.74e-43 157 34 13 376 3 hisC Histidinol-phosphate aminotransferase Roseiflexus sp. (strain RS-1)
A7NFV2 1.75e-43 157 33 12 377 3 hisC Histidinol-phosphate aminotransferase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q7NL03 4.37e-43 155 35 10 333 3 hisC Histidinol-phosphate aminotransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q58365 5.6e-43 156 32 17 372 3 hisC Histidinol-phosphate aminotransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A1BGB4 7.24e-43 155 32 10 359 3 hisC Histidinol-phosphate aminotransferase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
C0ZCE7 7.67e-43 155 34 9 310 3 hisC Histidinol-phosphate aminotransferase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
O28255 1.02e-42 154 33 13 354 3 hisC2 Histidinol-phosphate aminotransferase 2 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q18F03 1.38e-42 155 30 10 342 3 hisC Histidinol-phosphate aminotransferase Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q9FEW2 1.4e-42 155 32 11 363 1 HPA Histidinol-phosphate aminotransferase, chloroplastic Nicotiana plumbaginifolia
O82030 1.5e-42 155 33 11 363 2 HPA Histidinol-phosphate aminotransferase, chloroplastic Nicotiana tabacum
B3QP11 1.72e-42 154 32 8 338 3 hisC Histidinol-phosphate aminotransferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q4FSH2 5.79e-42 153 31 12 367 3 hisC1 Histidinol-phosphate aminotransferase 1 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q3Z879 6.95e-42 152 34 12 336 3 hisC Histidinol-phosphate aminotransferase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q3B3L3 7.55e-42 152 32 8 336 3 hisC Histidinol-phosphate aminotransferase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q65S79 8.46e-42 152 31 13 373 3 hisC1 Histidinol-phosphate aminotransferase 1 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q5KXV3 1.26e-41 152 32 14 364 3 hisC Histidinol-phosphate aminotransferase Geobacillus kaustophilus (strain HTA426)
Q5QZ49 1.6e-41 152 29 13 380 3 hisC1 Histidinol-phosphate aminotransferase 1 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B2UPR9 3.22e-41 151 31 11 365 3 hisC Histidinol-phosphate aminotransferase Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
A4IQ80 4.79e-41 150 31 13 369 3 hisC Histidinol-phosphate aminotransferase Geobacillus thermodenitrificans (strain NG80-2)
P17736 5.53e-41 150 31 9 347 3 hisC Histidinol-phosphate aminotransferase Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q311Z4 1.17e-40 150 33 9 311 3 hisC Histidinol-phosphate aminotransferase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q9KCA8 1.77e-40 149 31 10 352 3 hisC Histidinol-phosphate aminotransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A8AY31 6.14e-40 147 33 11 357 3 hisC Histidinol-phosphate aminotransferase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B1HTD4 6.45e-40 147 30 10 329 3 hisC Histidinol-phosphate aminotransferase Lysinibacillus sphaericus (strain C3-41)
Q8FNZ1 8.73e-40 147 33 12 342 3 hisC Histidinol-phosphate aminotransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
O27624 1.9e-39 146 33 11 329 3 hisC Histidinol-phosphate aminotransferase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A0PXP5 4.96e-39 145 27 9 357 3 hisC Histidinol-phosphate aminotransferase Clostridium novyi (strain NT)
A6UTL8 4.96e-39 145 30 15 333 3 hisC Histidinol-phosphate aminotransferase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
A5UKY0 5.07e-39 145 30 13 350 3 hisC Histidinol-phosphate aminotransferase Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Q72DA0 5.8e-39 145 30 10 377 1 hisC Histidinol-phosphate aminotransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A1VEW4 7.67e-39 145 30 10 377 3 hisC Histidinol-phosphate aminotransferase Nitratidesulfovibrio vulgaris (strain DP4)
Q6HL37 7.85e-39 145 31 10 316 3 hisC1 Histidinol-phosphate aminotransferase 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81SV5 1.32e-38 144 31 10 316 3 hisC1 Histidinol-phosphate aminotransferase 1 Bacillus anthracis
A6UPL6 1.43e-38 144 31 12 330 3 hisC Histidinol-phosphate aminotransferase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
A3CNT7 1.54e-38 144 32 11 357 3 hisC Histidinol-phosphate aminotransferase Streptococcus sanguinis (strain SK36)
Q73AX7 1.57e-38 144 31 10 316 3 hisC1 Histidinol-phosphate aminotransferase 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
A4FWW1 1.76e-38 144 32 15 333 3 hisC Histidinol-phosphate aminotransferase Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
P16246 1.96e-38 144 32 12 319 3 hisC Histidinol-phosphate aminotransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q63DL4 2e-38 144 31 10 316 3 hisC1 Histidinol-phosphate aminotransferase 1 Bacillus cereus (strain ZK / E33L)
P61003 2.59e-38 143 31 15 333 3 hisC Histidinol-phosphate aminotransferase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q5V4K3 4.06e-38 142 28 7 323 3 hisC Histidinol-phosphate aminotransferase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
B7GHJ8 4.22e-38 143 29 11 362 3 hisC Histidinol-phosphate aminotransferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q9HZ68 4.69e-38 142 29 12 367 3 hisC2 Histidinol-phosphate aminotransferase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2NEQ0 5.83e-38 142 30 15 346 3 hisC Histidinol-phosphate aminotransferase Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q2JPM4 9.94e-38 141 31 10 338 3 hisC Histidinol-phosphate aminotransferase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q0SHX9 1.09e-37 142 32 14 365 3 hisC Histidinol-phosphate aminotransferase Rhodococcus jostii (strain RHA1)
Q6ABU3 1.17e-37 141 30 10 355 3 pat Putative phenylalanine aminotransferase Cutibacterium acnes (strain DSM 16379 / KPA171202)
B9EAC1 1.82e-37 140 31 9 329 3 hisC Histidinol-phosphate aminotransferase Macrococcus caseolyticus (strain JCSC5402)
Q51687 2.25e-37 140 32 12 335 3 hisC Histidinol-phosphate aminotransferase Paracoccus denitrificans (strain Pd 1222)
P45358 2.4e-37 140 30 10 352 3 hisC Histidinol-phosphate aminotransferase Acetobacter pasteurianus
A7GN55 2.68e-37 140 31 11 317 3 hisC Histidinol-phosphate aminotransferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q82AA5 3.26e-37 140 31 10 316 3 hisC Histidinol-phosphate aminotransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q88UE6 3.46e-37 140 31 13 367 3 hisC Histidinol-phosphate aminotransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8TVG3 4.4e-37 140 32 11 308 3 hisC Histidinol-phosphate aminotransferase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q970Z4 5.08e-37 139 31 11 331 3 hisC Histidinol-phosphate aminotransferase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
A5FR29 5.81e-37 139 33 12 333 3 hisC Histidinol-phosphate aminotransferase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q4JW58 7.43e-37 139 32 12 342 3 hisC Histidinol-phosphate aminotransferase Corynebacterium jeikeium (strain K411)
Q47GP2 7.83e-37 139 29 12 358 3 hisC1 Histidinol-phosphate aminotransferase 1 Dechloromonas aromatica (strain RCB)
Q3ZXL8 7.93e-37 139 33 12 333 3 hisC Histidinol-phosphate aminotransferase Dehalococcoides mccartyi (strain CBDB1)
Q608S3 8.09e-37 139 27 10 377 3 hisC2 Histidinol-phosphate aminotransferase 2 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B9KPH4 8.69e-37 139 31 9 329 3 hisC Histidinol-phosphate aminotransferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3J445 9.84e-37 139 31 9 329 3 hisC Histidinol-phosphate aminotransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q8ESS3 1.02e-36 139 29 10 350 3 hisC1 Histidinol-phosphate aminotransferase 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B4U9L1 1.04e-36 139 30 7 302 3 hisC Histidinol-phosphate aminotransferase Hydrogenobaculum sp. (strain Y04AAS1)
Q31GD4 1.1e-36 139 29 9 326 3 hisC2 Histidinol-phosphate aminotransferase 2 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A5CVR5 1.18e-36 139 32 11 305 3 hisC Histidinol-phosphate aminotransferase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q10VS0 1.19e-36 139 31 9 327 3 hisC Histidinol-phosphate aminotransferase Trichodesmium erythraeum (strain IMS101)
A7Z614 1.43e-36 138 28 11 363 3 hisC Histidinol-phosphate aminotransferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q3M504 1.45e-36 138 31 14 356 3 hisC1 Histidinol-phosphate aminotransferase 1 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B9LNJ8 1.52e-36 139 30 7 327 3 hisC Histidinol-phosphate aminotransferase Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34)
Q9CMI7 1.58e-36 138 30 12 363 3 hisC2 Histidinol-phosphate aminotransferase 2 Pasteurella multocida (strain Pm70)
Q2SBJ7 1.6e-36 138 31 17 364 3 hisC Histidinol-phosphate aminotransferase Hahella chejuensis (strain KCTC 2396)
Q46Y48 1.76e-36 139 30 14 363 3 hisC1 Histidinol-phosphate aminotransferase 1 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B8FP20 1.81e-36 138 31 10 356 3 hisC Histidinol-phosphate aminotransferase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A3PIA4 2.25e-36 138 31 9 329 3 hisC Histidinol-phosphate aminotransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q9RRM7 2.63e-36 138 31 8 306 3 hisC Histidinol-phosphate aminotransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q3IRT1 3.15e-36 137 29 8 342 3 hisC Histidinol-phosphate aminotransferase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
A3Q130 3.48e-36 138 32 14 362 3 hisC Histidinol-phosphate aminotransferase Mycobacterium sp. (strain JLS)
A4QFG6 3.69e-36 137 30 12 344 3 hisC Histidinol-phosphate aminotransferase Corynebacterium glutamicum (strain R)
Q1B7G5 3.78e-36 138 32 14 362 3 hisC Histidinol-phosphate aminotransferase Mycobacterium sp. (strain MCS)
A1UHK7 3.78e-36 138 32 14 362 3 hisC Histidinol-phosphate aminotransferase Mycobacterium sp. (strain KMS)
B8DC01 4.33e-36 137 28 11 360 3 hisC Histidinol-phosphate aminotransferase Listeria monocytogenes serotype 4a (strain HCC23)
Q02YW3 5.34e-36 137 29 10 354 3 hisC Histidinol-phosphate aminotransferase Lactococcus lactis subsp. cremoris (strain SK11)
Q71Y90 5.49e-36 137 28 10 360 3 hisC Histidinol-phosphate aminotransferase Listeria monocytogenes serotype 4b (strain F2365)
Q9KJU4 6.12e-36 137 30 12 344 1 hisC Histidinol-phosphate aminotransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q2JTG5 7.22e-36 136 30 12 363 3 hisC Histidinol-phosphate aminotransferase Synechococcus sp. (strain JA-3-3Ab)
Q8DTQ4 7.7e-36 136 31 12 356 3 hisC Histidinol-phosphate aminotransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A6VGF6 7.87e-36 137 31 15 333 3 hisC Histidinol-phosphate aminotransferase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
C1ATZ5 1.02e-35 137 32 13 364 3 hisC Histidinol-phosphate aminotransferase Rhodococcus opacus (strain B4)
Q8Y0Y8 1.21e-35 136 31 13 363 3 hisC2 Histidinol-phosphate aminotransferase 2 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q6AQK2 1.35e-35 136 27 12 367 3 hisC Histidinol-phosphate aminotransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B1N009 1.83e-35 135 31 8 318 3 hisC Histidinol-phosphate aminotransferase Leuconostoc citreum (strain KM20)
Q2J8K9 1.9e-35 136 30 12 377 3 hisC Histidinol-phosphate aminotransferase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
C1KWM5 2.51e-35 135 28 10 360 3 hisC Histidinol-phosphate aminotransferase Listeria monocytogenes serotype 4b (strain CLIP80459)
A8FEJ6 2.6e-35 135 27 9 362 3 hisC Histidinol-phosphate aminotransferase Bacillus pumilus (strain SAFR-032)
A7HCR6 2.63e-35 135 29 10 359 3 hisC Histidinol-phosphate aminotransferase Anaeromyxobacter sp. (strain Fw109-5)
Q03VY3 2.82e-35 135 30 10 351 3 hisC Histidinol-phosphate aminotransferase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B2HQA3 3.93e-35 135 29 14 372 3 hisC Histidinol-phosphate aminotransferase Mycobacterium marinum (strain ATCC BAA-535 / M)
A2SE05 4.5e-35 135 33 9 307 3 hisC Histidinol-phosphate aminotransferase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q24QJ1 5.34e-35 134 29 9 354 3 hisC Histidinol-phosphate aminotransferase Desulfitobacterium hafniense (strain Y51)
Q63Q87 5.47e-35 134 32 14 356 3 hisC2 Histidinol-phosphate aminotransferase 2 Burkholderia pseudomallei (strain K96243)
Q62GE0 5.47e-35 134 32 14 356 3 hisC1 Histidinol-phosphate aminotransferase 1 Burkholderia mallei (strain ATCC 23344)
Q4K8N0 5.48e-35 134 29 12 370 3 hisC2 Histidinol-phosphate aminotransferase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A9AA96 5.82e-35 134 31 15 333 3 hisC Histidinol-phosphate aminotransferase Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
Q3JMZ7 5.94e-35 134 32 14 356 3 hisC2 Histidinol-phosphate aminotransferase 2 Burkholderia pseudomallei (strain 1710b)
A4WUN9 6.1e-35 134 30 9 329 3 hisC Histidinol-phosphate aminotransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q3SI68 6.45e-35 134 31 10 352 3 hisC2 Histidinol-phosphate aminotransferase 2 Thiobacillus denitrificans (strain ATCC 25259)
Q39CT7 9.87e-35 133 30 13 355 3 hisC2 Histidinol-phosphate aminotransferase 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8KZ92 1e-34 134 28 9 356 3 hisC Histidinol-phosphate aminotransferase Bacillus subtilis subsp. natto
Q39K90 1.13e-34 133 30 14 359 3 hisC1 Histidinol-phosphate aminotransferase 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A1R558 1.16e-34 134 29 12 360 3 hisC Histidinol-phosphate aminotransferase Paenarthrobacter aurescens (strain TC1)
Q8Y5X8 1.17e-34 133 29 13 356 3 hisC Histidinol-phosphate aminotransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B1WY56 1.41e-34 133 29 14 353 3 hisC Histidinol-phosphate aminotransferase Crocosphaera subtropica (strain ATCC 51142 / BH68)
C5D3D2 1.53e-34 133 28 13 366 3 hisC Histidinol-phosphate aminotransferase Geobacillus sp. (strain WCH70)
A0QX82 1.55e-34 133 32 15 374 3 hisC Histidinol-phosphate aminotransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A0PP15 1.69e-34 133 29 14 372 3 hisC Histidinol-phosphate aminotransferase Mycobacterium ulcerans (strain Agy99)
P17731 1.73e-34 133 28 9 356 3 hisC Histidinol-phosphate aminotransferase Bacillus subtilis (strain 168)
Q5X3Q5 1.78e-34 133 25 9 379 3 hisC2 Histidinol-phosphate aminotransferase 2 Legionella pneumophila (strain Paris)
Q12U08 1.9e-34 133 29 12 334 3 hisC Histidinol-phosphate aminotransferase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
A0QHI1 2.13e-34 133 32 12 341 3 hisC Histidinol-phosphate aminotransferase Mycobacterium avium (strain 104)
Q0W253 2.24e-34 132 34 11 295 3 hisC Histidinol-phosphate aminotransferase Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
P61001 2.46e-34 133 32 12 341 3 hisC Histidinol-phosphate aminotransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P60999 2.72e-34 132 30 12 343 3 hisC Histidinol-phosphate aminotransferase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q5WV43 3.36e-34 132 25 9 379 3 hisC2 Histidinol-phosphate aminotransferase 2 Legionella pneumophila (strain Lens)
A0AK37 3.6e-34 132 27 11 360 3 hisC Histidinol-phosphate aminotransferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A1VK38 4.04e-34 132 32 10 307 3 hisC Histidinol-phosphate aminotransferase Polaromonas naphthalenivorans (strain CJ2)
Q3AD52 7.13e-34 131 31 13 347 3 hisC1 Histidinol-phosphate aminotransferase 1 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A1A2H6 7.99e-34 132 32 14 356 3 hisC Histidinol-phosphate aminotransferase Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
A1TKZ0 8.04e-34 131 29 11 338 3 hisC Histidinol-phosphate aminotransferase Paracidovorax citrulli (strain AAC00-1)
Q5ZU10 8.66e-34 131 25 9 379 3 hisC2 Histidinol-phosphate aminotransferase 2 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q3J7H2 8.9e-34 131 29 12 329 3 hisC2 Histidinol-phosphate aminotransferase 2 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B9MDV4 1.03e-33 131 29 12 360 3 hisC Histidinol-phosphate aminotransferase Acidovorax ebreus (strain TPSY)
A4XMY1 1.15e-33 130 28 14 367 3 hisC Histidinol-phosphate aminotransferase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q3K8U2 1.37e-33 130 28 12 367 3 hisC2 Histidinol-phosphate aminotransferase 2 Pseudomonas fluorescens (strain Pf0-1)
Q9HQS0 1.65e-33 130 28 9 350 3 hisC Histidinol-phosphate aminotransferase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R4Q4 1.65e-33 130 28 9 350 3 hisC Histidinol-phosphate aminotransferase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q3JEN8 1.79e-33 130 27 11 367 3 hisC1 Histidinol-phosphate aminotransferase 1 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q9X7B8 1.89e-33 130 29 13 363 3 hisC Histidinol-phosphate aminotransferase Mycobacterium leprae (strain TN)
B8ZRB0 1.89e-33 130 29 13 363 3 hisC Histidinol-phosphate aminotransferase Mycobacterium leprae (strain Br4923)
A5G9G1 2.02e-33 130 30 10 325 3 hisC Histidinol-phosphate aminotransferase Geotalea uraniireducens (strain Rf4)
Q97ES6 2.3e-33 130 30 11 355 3 hisC Histidinol-phosphate aminotransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
O28277 2.85e-33 129 30 7 326 3 hisC1 Histidinol-phosphate aminotransferase 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O07131 3.36e-33 129 28 11 354 3 hisC Histidinol-phosphate aminotransferase Methylobacillus flagellatus
Q82XE0 4.52e-33 129 27 12 373 3 hisC2 Histidinol-phosphate aminotransferase 2 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q845V2 4.57e-33 129 31 15 356 3 hisC Histidinol-phosphate aminotransferase Burkholderia multivorans (strain ATCC 17616 / 249)
O67857 5.55e-33 129 28 12 342 3 hisC Histidinol-phosphate aminotransferase Aquifex aeolicus (strain VF5)
Q02135 6.95e-33 129 29 12 360 3 hisC Histidinol-phosphate aminotransferase Lactococcus lactis subsp. lactis (strain IL1403)
Q46E46 7.37e-33 129 29 11 334 3 hisC Histidinol-phosphate aminotransferase Methanosarcina barkeri (strain Fusaro / DSM 804)
P9WML7 7.62e-33 129 31 12 339 1 hisC Histidinol-phosphate aminotransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WML6 7.62e-33 129 31 12 339 3 hisC Histidinol-phosphate aminotransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U2V6 7.62e-33 129 31 12 339 3 hisC Histidinol-phosphate aminotransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1ANM2 7.62e-33 129 31 12 339 3 hisC Histidinol-phosphate aminotransferase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KJ16 7.62e-33 129 31 12 339 3 hisC Histidinol-phosphate aminotransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A679 7.62e-33 129 31 12 339 3 hisC Histidinol-phosphate aminotransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8YV89 7.8e-33 128 29 12 354 3 hisC1 Histidinol-phosphate aminotransferase 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A6LUF3 8.57e-33 128 28 11 353 3 hisC Histidinol-phosphate aminotransferase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A2RKS5 8.96e-33 128 28 10 354 3 hisC Histidinol-phosphate aminotransferase Lactococcus lactis subsp. cremoris (strain MG1363)
B9LZ53 9e-33 128 30 10 325 3 hisC Histidinol-phosphate aminotransferase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q1R089 1e-32 128 32 16 356 3 hisC Histidinol-phosphate aminotransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q8DM42 1.11e-32 128 31 13 307 3 hisC Histidinol-phosphate aminotransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q65I37 1.3e-32 128 26 10 367 3 hisC Histidinol-phosphate aminotransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q62FC0 1.38e-32 127 30 14 357 3 hisC2 Histidinol-phosphate aminotransferase 2 Burkholderia mallei (strain ATCC 23344)
Q67KI2 1.8e-32 127 29 12 359 3 hisC Histidinol-phosphate aminotransferase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q8EQB9 2.11e-32 127 28 11 356 3 hisC2 Histidinol-phosphate aminotransferase 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9RI00 2.63e-32 127 30 14 370 3 hisC Histidinol-phosphate aminotransferase Stutzerimonas stutzeri
Q63XM1 3.13e-32 127 30 14 357 3 hisC1 Histidinol-phosphate aminotransferase 1 Burkholderia pseudomallei (strain K96243)
Q3JW89 3.13e-32 127 30 14 357 3 hisC1 Histidinol-phosphate aminotransferase 1 Burkholderia pseudomallei (strain 1710b)
Q1GP30 3.45e-32 127 29 12 374 3 hisC Histidinol-phosphate aminotransferase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q2RL44 3.56e-32 127 27 10 361 3 hisC Histidinol-phosphate aminotransferase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A1T8W2 6.07e-32 126 30 11 343 3 hisC Histidinol-phosphate aminotransferase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q9ZBY8 6.51e-32 126 28 10 349 3 pat Putative phenylalanine aminotransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A3CWS8 6.82e-32 125 30 11 342 3 hisC Histidinol-phosphate aminotransferase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q5YYP9 8.94e-32 126 30 12 360 3 hisC Histidinol-phosphate aminotransferase Nocardia farcinica (strain IFM 10152)
C1B997 8.96e-32 125 30 10 352 3 pat Putative phenylalanine aminotransferase Rhodococcus opacus (strain B4)
Q81FQ1 9.61e-32 125 30 10 317 3 hisC1 Histidinol-phosphate aminotransferase 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q92A83 9.98e-32 125 27 11 361 1 hisC Histidinol-phosphate aminotransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q4KI72 1.06e-31 125 29 12 351 3 hisC1 Histidinol-phosphate aminotransferase 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B7JUI4 1.27e-31 125 28 14 360 3 hisC Histidinol-phosphate aminotransferase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q3A7R3 1.55e-31 125 30 10 329 3 hisC Histidinol-phosphate aminotransferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q63A05 2.59e-31 124 28 8 320 3 hisC2 Histidinol-phosphate aminotransferase 2 Bacillus cereus (strain ZK / E33L)
B3PCJ2 3.05e-31 124 30 11 351 3 hisC Histidinol-phosphate aminotransferase Cellvibrio japonicus (strain Ueda107)
C6E916 3.6e-31 124 29 10 330 3 hisC Histidinol-phosphate aminotransferase Geobacter sp. (strain M21)
B1VP97 4.23e-31 124 29 10 328 3 pat Putative phenylalanine aminotransferase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q4ZNW0 4.33e-31 124 29 12 353 3 hisC Histidinol-phosphate aminotransferase Pseudomonas syringae pv. syringae (strain B728a)
Q7W2Y3 5.53e-31 124 30 14 370 3 hisC2 Histidinol-phosphate aminotransferase 2 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WDY3 6.31e-31 123 30 14 370 3 hisC2 Histidinol-phosphate aminotransferase 2 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q3AAT6 6.37e-31 123 27 13 371 3 hisC2 Histidinol-phosphate aminotransferase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q3SK85 7.52e-31 124 28 10 347 3 hisC1 Histidinol-phosphate aminotransferase 1 Thiobacillus denitrificans (strain ATCC 25259)
C0R1Z0 8.16e-31 123 26 10 350 3 hisC Histidinol-phosphate aminotransferase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q736A5 1.01e-30 123 28 7 306 3 hisC2 Histidinol-phosphate aminotransferase 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
C0ZM44 1.05e-30 122 31 8 300 3 pat Putative phenylalanine aminotransferase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q48ED0 1.1e-30 122 29 13 353 3 hisC Histidinol-phosphate aminotransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8YMG7 1.26e-30 123 29 11 329 3 hisC2 Histidinol-phosphate aminotransferase 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8TUE9 1.32e-30 122 29 12 337 3 hisC Histidinol-phosphate aminotransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
B5E9W9 1.35e-30 122 28 11 352 3 hisC Histidinol-phosphate aminotransferase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q5WGR9 1.48e-30 122 28 11 361 3 hisC Histidinol-phosphate aminotransferase Shouchella clausii (strain KSM-K16)
Q81P62 1.5e-30 122 28 7 306 3 hisC2 Histidinol-phosphate aminotransferase 2 Bacillus anthracis
Q6HHF6 1.56e-30 122 28 7 306 3 hisC2 Histidinol-phosphate aminotransferase 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
B0JJJ7 1.59e-30 122 29 11 360 3 hisC Histidinol-phosphate aminotransferase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q5HWF4 1.67e-30 122 28 9 307 3 hisC Histidinol-phosphate aminotransferase Campylobacter jejuni (strain RM1221)
Q47QS8 1.7e-30 122 30 12 360 3 hisC Histidinol-phosphate aminotransferase Thermobifida fusca (strain YX)
O33770 1.82e-30 122 32 14 337 3 hisC Histidinol-phosphate aminotransferase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q87WV6 1.98e-30 122 29 13 353 3 hisC Histidinol-phosphate aminotransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q6A8L4 2.19e-30 122 33 13 338 3 hisC Histidinol-phosphate aminotransferase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q8PX17 2.23e-30 122 28 11 333 3 hisC Histidinol-phosphate aminotransferase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q46WL3 2.57e-30 122 28 13 367 1 hisC2 Histidinol-phosphate aminotransferase 2 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A8FKA6 2.66e-30 122 28 9 307 3 hisC Histidinol-phosphate aminotransferase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q9PII2 3.1e-30 121 28 9 307 1 hisC Histidinol-phosphate aminotransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q4JSJ5 3.99e-30 121 29 8 311 3 pat Putative phenylalanine aminotransferase Corynebacterium jeikeium (strain K411)
Q7VSZ0 4.03e-30 121 30 14 370 3 hisC2 Histidinol-phosphate aminotransferase 2 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q3MAX6 4.65e-30 121 30 12 329 3 hisC2 Histidinol-phosphate aminotransferase 2 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A1W431 5.35e-30 121 28 11 359 3 hisC Histidinol-phosphate aminotransferase Acidovorax sp. (strain JS42)
Q4FQF9 6.26e-30 121 30 11 366 3 hisC2 Histidinol-phosphate aminotransferase 2 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q2RP86 6.36e-30 120 27 12 359 3 hisC Histidinol-phosphate aminotransferase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q1GET3 6.43e-30 120 28 9 333 3 hisC Histidinol-phosphate aminotransferase Ruegeria sp. (strain TM1040)
Q8CTG8 6.93e-30 120 27 7 334 3 hisC Histidinol-phosphate aminotransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q89GX0 7.17e-30 120 29 11 352 3 hisC1 Histidinol-phosphate aminotransferase 1 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A4QAL4 7.41e-30 120 27 10 354 3 pat Putative phenylalanine aminotransferase Corynebacterium glutamicum (strain R)
Q5HR08 7.44e-30 120 27 7 334 3 hisC Histidinol-phosphate aminotransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
C3KVX5 7.76e-30 120 25 11 350 3 hisC Histidinol-phosphate aminotransferase Clostridium botulinum (strain 657 / Type Ba4)
A0R5X8 8.32e-30 120 31 12 335 1 pat Putative phenylalanine aminotransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q81C43 8.6e-30 120 28 7 306 3 hisC2 Histidinol-phosphate aminotransferase 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8NXN3 1.45e-29 119 28 11 363 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain MW2)
Q6GBA6 1.45e-29 119 28 11 363 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain MSSA476)
Q49VS0 1.7e-29 119 29 13 350 3 hisC Histidinol-phosphate aminotransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B1MFC0 1.77e-29 119 29 8 300 3 pat Putative phenylalanine aminotransferase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q2YSI3 1.89e-29 119 28 11 363 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
A1VY36 2.62e-29 119 28 9 307 3 hisC Histidinol-phosphate aminotransferase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
B1ILA9 3.1e-29 119 25 11 350 3 hisC Histidinol-phosphate aminotransferase Clostridium botulinum (strain Okra / Type B1)
Q8G4S8 3.31e-29 119 30 11 355 3 hisC Histidinol-phosphate aminotransferase Bifidobacterium longum (strain NCC 2705)
Q31I36 3.51e-29 118 28 14 357 3 hisC1 Histidinol-phosphate aminotransferase 1 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q5LNM6 4.31e-29 118 28 12 342 3 hisC Histidinol-phosphate aminotransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q6GIR8 4.31e-29 118 28 11 363 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain MRSA252)
A7H084 4.84e-29 118 27 9 309 3 hisC Histidinol-phosphate aminotransferase Campylobacter curvus (strain 525.92)
A8YZZ5 4.97e-29 118 28 11 363 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain USA300 / TCH1516)
P67725 4.97e-29 118 28 11 363 1 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain N315)
P67724 4.97e-29 118 28 11 363 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QF32 4.97e-29 118 28 11 363 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain Newman)
Q5HHU9 4.97e-29 118 28 11 363 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain COL)
A5IQS7 4.97e-29 118 28 11 363 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain JH9)
Q2G087 4.97e-29 118 28 11 363 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIR7 4.97e-29 118 28 11 363 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain USA300)
A6TZK2 4.97e-29 118 28 11 363 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain JH1)
A7WZL0 4.97e-29 118 28 11 363 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8XV80 5.21e-29 118 30 13 364 3 hisC1 Histidinol-phosphate aminotransferase 1 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P73807 5.56e-29 118 30 12 352 3 hisC Histidinol-phosphate aminotransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B9K9R9 6.46e-29 117 27 13 353 3 hisC Histidinol-phosphate aminotransferase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
A7H556 6.52e-29 118 28 9 307 3 hisC Histidinol-phosphate aminotransferase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A7GDQ6 6.77e-29 117 25 11 343 3 hisC Histidinol-phosphate aminotransferase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
P61004 7.35e-29 117 29 7 285 3 pat Putative phenylalanine aminotransferase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q7M7Y6 8.81e-29 117 27 10 311 3 hisC Histidinol-phosphate aminotransferase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P60998 8.97e-29 117 28 10 353 3 hisC Histidinol-phosphate aminotransferase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B2GBR8 1.09e-28 117 29 8 322 3 hisC Histidinol-phosphate aminotransferase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
C1FN41 2.4e-28 116 24 11 350 3 hisC Histidinol-phosphate aminotransferase Clostridium botulinum (strain Kyoto / Type A2)
A5I245 2.58e-28 116 25 11 350 3 hisC Histidinol-phosphate aminotransferase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FU81 2.58e-28 116 25 11 350 3 hisC Histidinol-phosphate aminotransferase Clostridium botulinum (strain ATCC 19397 / Type A)
Q39M27 3.14e-28 116 30 11 344 3 hisC3 Histidinol-phosphate aminotransferase 3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A6VUD3 3.44e-28 115 28 11 352 3 hisC Histidinol-phosphate aminotransferase Marinomonas sp. (strain MWYL1)
A8MEH2 3.78e-28 116 26 11 367 3 hisC Histidinol-phosphate aminotransferase Alkaliphilus oremlandii (strain OhILAs)
Q82FJ1 3.87e-28 115 28 10 324 3 pat Putative phenylalanine aminotransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q1IE97 4.89e-28 115 28 10 350 3 hisC Histidinol-phosphate aminotransferase Pseudomonas entomophila (strain L48)
A5FVN2 5.79e-28 115 29 12 360 3 hisC Histidinol-phosphate aminotransferase Acidiphilium cryptum (strain JF-5)
Q8NTT4 6.32e-28 115 28 7 304 3 pat Probable phenylalanine aminotransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q3KHZ1 6.92e-28 115 28 12 351 3 hisC1 Histidinol-phosphate aminotransferase 1 Pseudomonas fluorescens (strain Pf0-1)
Q5FQA6 7.66e-28 115 30 11 355 3 hisC2 Histidinol-phosphate aminotransferase 2 Gluconobacter oxydans (strain 621H)
B9DK21 7.93e-28 115 27 5 303 3 hisC Histidinol-phosphate aminotransferase Staphylococcus carnosus (strain TM300)
P61000 8.38e-28 114 28 10 328 3 hisC Histidinol-phosphate aminotransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B2IDA4 8.41e-28 115 27 10 334 3 hisC Histidinol-phosphate aminotransferase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q82WM3 8.77e-28 115 26 11 315 3 hisC1 Histidinol-phosphate aminotransferase 1 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q163G3 1.26e-27 114 29 11 334 3 hisC Histidinol-phosphate aminotransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q2LST8 1.5e-27 114 25 9 359 3 hisC Histidinol-phosphate aminotransferase Syntrophus aciditrophicus (strain SB)
A0RMN9 1.55e-27 114 26 10 342 3 hisC Histidinol-phosphate aminotransferase Campylobacter fetus subsp. fetus (strain 82-40)
B7I6C5 1.56e-27 114 29 14 359 3 hisC Histidinol-phosphate aminotransferase Acinetobacter baumannii (strain AB0057)
B7GZI3 1.56e-27 114 29 14 359 3 hisC Histidinol-phosphate aminotransferase Acinetobacter baumannii (strain AB307-0294)
B0V7Q2 1.89e-27 114 29 14 357 3 hisC Histidinol-phosphate aminotransferase Acinetobacter baumannii (strain AYE)
B2HTW5 1.89e-27 114 29 14 357 3 hisC Histidinol-phosphate aminotransferase Acinetobacter baumannii (strain ACICU)
Q2W047 2.03e-27 114 29 8 310 3 hisC Histidinol-phosphate aminotransferase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q9X0D0 2.26e-27 113 28 13 346 1 hisC Histidinol-phosphate aminotransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q2Y6Y6 2.91e-27 114 26 15 371 3 hisC2 Histidinol-phosphate aminotransferase 2 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q4L4E7 3.01e-27 113 29 7 303 3 hisC Histidinol-phosphate aminotransferase Staphylococcus haemolyticus (strain JCSC1435)
B8HW95 3.02e-27 114 29 11 347 3 hisC Histidinol-phosphate aminotransferase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
B1JBC0 3.41e-27 113 30 12 351 3 hisC Histidinol-phosphate aminotransferase Pseudomonas putida (strain W619)
A8LK96 3.53e-27 113 28 9 328 3 hisC Histidinol-phosphate aminotransferase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B0VV21 3.75e-27 113 29 14 359 3 hisC Histidinol-phosphate aminotransferase Acinetobacter baumannii (strain SDF)
Q5P791 4.93e-27 112 28 12 355 3 hisC Histidinol-phosphate aminotransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q0P8H7 5.22e-27 112 28 13 363 1 Cj1437c Dihydroxyacetone phosphate transaminase Cj1437c Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q88P86 6.5e-27 112 28 13 358 3 hisC Histidinol-phosphate aminotransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B9KDN6 6.52e-27 112 28 10 336 3 hisC Histidinol-phosphate aminotransferase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
B1L869 6.75e-27 112 28 13 346 3 hisC Histidinol-phosphate aminotransferase Thermotoga sp. (strain RQ2)
A3M2I8 7.06e-27 112 29 14 359 3 hisC Histidinol-phosphate aminotransferase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
A7ZCF3 7.97e-27 112 26 9 314 3 hisC Histidinol-phosphate aminotransferase Campylobacter concisus (strain 13826)
B0KQJ6 8.19e-27 112 29 13 358 3 hisC Histidinol-phosphate aminotransferase Pseudomonas putida (strain GB-1)
A8EWM9 9.54e-27 112 26 13 330 3 hisC Histidinol-phosphate aminotransferase Aliarcobacter butzleri (strain RM4018)
A3Q7J9 1.09e-26 112 29 12 319 3 pat Putative phenylalanine aminotransferase Mycobacterium sp. (strain JLS)
A9H311 1.13e-26 112 29 13 362 3 hisC Histidinol-phosphate aminotransferase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q1B1Z8 1.15e-26 112 29 12 319 3 pat Putative phenylalanine aminotransferase Mycobacterium sp. (strain MCS)
A1UN51 1.15e-26 112 29 12 319 3 pat Putative phenylalanine aminotransferase Mycobacterium sp. (strain KMS)
Q8FU28 1.17e-26 111 27 12 353 3 pat Putative phenylalanine aminotransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A5VZ57 1.34e-26 111 28 13 358 3 hisC Histidinol-phosphate aminotransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B6IYQ0 2.54e-26 110 28 8 310 3 hisC Histidinol-phosphate aminotransferase Rhodospirillum centenum (strain ATCC 51521 / SW)
Q2GAI1 2.58e-26 111 27 10 348 3 hisC Histidinol-phosphate aminotransferase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q20YH9 2.65e-26 110 26 11 361 3 hisC Histidinol-phosphate aminotransferase Rhodopseudomonas palustris (strain BisB18)
Q9A5B6 2.67e-26 111 31 12 299 3 hisC2 Histidinol-phosphate aminotransferase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A5INE2 3.36e-26 110 26 13 350 3 hisC Histidinol-phosphate aminotransferase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q39YP6 3.75e-26 110 28 12 330 1 hisC Histidinol-phosphate aminotransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q47KH1 4.8e-26 110 27 12 357 3 pat Putative phenylalanine aminotransferase Thermobifida fusca (strain YX)
A8HZS2 5.06e-26 110 27 9 338 3 hisC Histidinol-phosphate aminotransferase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q89UL9 6.16e-26 110 26 10 360 3 hisC2 Histidinol-phosphate aminotransferase 2 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q30TC9 6.77e-26 109 24 10 311 3 hisC Histidinol-phosphate aminotransferase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q7WHN5 7.81e-26 109 27 9 352 3 hisC1 Histidinol-phosphate aminotransferase 1 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W6Q1 8.81e-26 109 27 9 352 3 hisC1 Histidinol-phosphate aminotransferase 1 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q03K75 9.07e-26 109 27 11 359 3 hisC Histidinol-phosphate aminotransferase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q0BVW4 9.38e-26 109 28 9 313 3 hisC Histidinol-phosphate aminotransferase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q1AY33 9.4e-26 109 31 10 282 3 hisC Histidinol-phosphate aminotransferase Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q28TL1 1.15e-25 109 27 12 347 3 hisC Histidinol-phosphate aminotransferase Jannaschia sp. (strain CCS1)
Q0S962 1.31e-25 108 30 8 311 3 pat Putative phenylalanine aminotransferase Rhodococcus jostii (strain RHA1)
Q0AM22 1.38e-25 108 26 10 314 3 hisC Histidinol-phosphate aminotransferase Maricaulis maris (strain MCS10)
Q7VIJ3 1.54e-25 108 26 13 343 3 hisC Histidinol-phosphate aminotransferase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A6Q1Z5 1.93e-25 108 25 11 336 3 hisC Histidinol-phosphate aminotransferase Nitratiruptor sp. (strain SB155-2)
Q6FEC7 2.63e-25 108 28 13 357 3 hisC Histidinol-phosphate aminotransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q11DR9 3.15e-25 108 27 12 359 3 hisC Histidinol-phosphate aminotransferase Chelativorans sp. (strain BNC1)
Q9JYH7 3.26e-25 107 28 13 363 3 hisC Histidinol-phosphate aminotransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q7P0F4 3.27e-25 107 30 10 280 3 hisC Histidinol-phosphate aminotransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A1TGS6 3.49e-25 107 30 10 306 3 pat Putative phenylalanine aminotransferase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q2YAU6 3.51e-25 107 27 15 358 3 hisC1 Histidinol-phosphate aminotransferase 1 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q7VWL5 3.65e-25 107 27 9 352 3 hisC1 Histidinol-phosphate aminotransferase 1 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q4FP52 3.82e-25 107 24 9 313 3 hisC Histidinol-phosphate aminotransferase Pelagibacter ubique (strain HTCC1062)
B4RJ05 4.08e-25 107 30 9 283 3 hisC Histidinol-phosphate aminotransferase Neisseria gonorrhoeae (strain NCCP11945)
Q5F7D7 4.08e-25 107 30 9 283 3 hisC Histidinol-phosphate aminotransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B8GIB0 4.22e-25 107 29 10 305 3 hisC Histidinol-phosphate aminotransferase Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Q5FRR4 4.38e-25 108 24 11 373 3 hisC1 Histidinol-phosphate aminotransferase 1 Gluconobacter oxydans (strain 621H)
Q5N4R3 4.63e-25 107 29 10 326 3 hisC Histidinol-phosphate aminotransferase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q9HVX0 4.71e-25 107 27 14 360 3 hisC1 Histidinol-phosphate aminotransferase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q31PF9 4.86e-25 107 29 10 326 3 hisC Histidinol-phosphate aminotransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q92MG0 4.87e-25 107 28 10 337 3 hisC1 Histidinol-phosphate aminotransferase 1 Rhizobium meliloti (strain 1021)
A0Q9F3 6.74e-25 107 30 12 340 3 pat Putative phenylalanine aminotransferase Mycobacterium avium (strain 104)
Q47AL9 7.56e-25 106 27 11 354 3 hisC2 Histidinol-phosphate aminotransferase 2 Dechloromonas aromatica (strain RCB)
P61005 8.07e-25 106 30 12 340 3 pat Putative phenylalanine aminotransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q04Z75 8.9e-25 106 28 12 321 3 hisC Histidinol-phosphate aminotransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04QW8 8.9e-25 106 28 12 321 3 hisC Histidinol-phosphate aminotransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q609W4 1.18e-24 106 28 12 355 3 hisC1 Histidinol-phosphate aminotransferase 1 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q6ABX6 1.32e-24 106 34 6 238 3 pat Putative phenylalanine aminotransferase Leifsonia xyli subsp. xyli (strain CTCB07)
A6QBY8 1.99e-24 105 27 9 281 3 hisC Histidinol-phosphate aminotransferase Sulfurovum sp. (strain NBC37-1)
Q1QQD5 2.02e-24 105 26 10 354 3 hisC Histidinol-phosphate aminotransferase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B0UN04 2.76e-24 105 27 9 335 3 hisC Histidinol-phosphate aminotransferase Methylobacterium sp. (strain 4-46)
Q3SV41 2.8e-24 105 26 9 356 3 hisC Histidinol-phosphate aminotransferase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q07IG8 3.48e-24 105 26 11 360 3 hisC Histidinol-phosphate aminotransferase Rhodopseudomonas palustris (strain BisA53)
A1KV06 4e-24 105 27 13 363 3 hisC Histidinol-phosphate aminotransferase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JTH8 4e-24 105 27 13 363 3 hisC Histidinol-phosphate aminotransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M185 4e-24 105 27 13 363 3 hisC Histidinol-phosphate aminotransferase Neisseria meningitidis serogroup C (strain 053442)
A7ICA9 4.25e-24 105 26 10 343 3 hisC Histidinol-phosphate aminotransferase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03265
Feature type CDS
Gene hisC
Product histidinol-phosphate transaminase
Location 720858 - 721940 (strand: -1)
Length 1083 (nucleotides) / 360 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_288
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00155 Aminotransferase class I and II

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0079 Amino acid transport and metabolism (E) E Histidinol-phosphate/aromatic aminotransferase or cobyric acid decarboxylase

Kegg Ortholog Annotation(s)

Protein Sequence

MNTPFDITLLARKNVRQLTPYQSARRLGGNGSVWLNANEYPTAPDFTFNEKNLNRYPECQPVNVINRYAAYAGVQPEQVLVSRGADEAIELLIRAFCEPGKDAVLYCPPTYGMYSVSAETFGVEQRVVPALADWEPDVKAIASQLDNVKLIYLCSPNNPTGNIVDPSLIREVLALAKDKAIVAIDEAYIEFCPQASLVTWLKEYPNLVILRTLSKAFALAGLRCGFALANSPVIELLLKVIAPYPLSTPVADIAAQALTDQGIEAMKQRVTEIVRNRTYLADALKNLPNVEQVYCSETNYILVKFTDADCVFRSLWEQGIILRDQQRQYGLAGCLRISIGTRQECDSVITAIKNRQTANV

Flanking regions ( +/- flanking 50bp)

AATGCCGTCACACTTCGCGTTAACGCCTTGGCTCAAGGAGATAACTAGCTATGAACACGCCCTTTGATATTACCCTATTAGCCAGAAAAAATGTTCGCCAGTTAACCCCTTATCAATCAGCGAGACGTTTAGGTGGAAATGGCTCGGTTTGGTTAAATGCCAATGAATACCCTACCGCTCCTGACTTTACGTTTAATGAAAAAAATTTAAACCGCTACCCTGAGTGTCAGCCGGTTAACGTAATTAATCGCTATGCAGCATATGCAGGCGTCCAACCTGAGCAAGTGTTAGTTAGCCGAGGTGCCGATGAAGCGATAGAACTACTGATCCGTGCTTTTTGTGAGCCTGGTAAAGATGCTGTTCTCTATTGTCCACCCACTTATGGTATGTACAGCGTCAGTGCGGAAACCTTTGGTGTAGAACAGCGTGTTGTCCCTGCTCTTGCTGATTGGGAGCCTGATGTCAAAGCCATTGCATCACAACTTGATAATGTAAAACTTATCTACCTATGTAGTCCCAATAACCCAACAGGCAATATCGTTGATCCTTCACTGATCCGCGAAGTATTAGCATTAGCAAAAGATAAAGCCATTGTGGCTATTGACGAAGCTTATATTGAGTTTTGTCCTCAAGCATCACTAGTCACTTGGTTAAAAGAGTATCCGAATTTAGTCATTTTGCGAACTCTCTCTAAAGCTTTTGCATTAGCGGGACTGCGTTGTGGCTTTGCACTTGCCAATTCACCTGTTATTGAATTATTACTTAAGGTGATCGCCCCTTACCCACTTTCTACCCCGGTTGCTGATATTGCGGCACAAGCATTAACTGACCAAGGTATAGAAGCGATGAAACAACGGGTAACGGAAATTGTACGCAATAGAACATATTTAGCGGATGCACTAAAAAATTTACCCAATGTTGAACAGGTTTATTGTAGTGAAACCAACTATATTTTAGTGAAATTCACTGATGCTGATTGTGTTTTCCGCAGTTTATGGGAGCAAGGGATTATTTTACGCGATCAACAGCGTCAATATGGGCTGGCAGGTTGTTTACGCATCTCTATCGGTACGCGTCAAGAGTGTGATAGCGTGATAACCGCTATAAAAAATAGGCAAACGGCAAACGTATAAACATCACCAATGATAACAATAAAAATCACCACTGAGGGATCTCAACCATG