Homologs in group_154

Help

9 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17540 FBDBKF_17540 100.0 Morganella morganii S1 tuf elongation factor Tu
EHELCC_19980 EHELCC_19980 100.0 Morganella morganii S2 - hypothetical protein
LHKJJB_19935 LHKJJB_19935 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_19750 HKOGLL_19750 100.0 Morganella morganii S5 - hypothetical protein
F4V73_RS14925 F4V73_RS14925 95.6 Morganella psychrotolerans tuf elongation factor Tu
F4V73_RS18900 F4V73_RS18900 95.6 Morganella psychrotolerans tuf elongation factor Tu
PMI_RS11060 PMI_RS11060 34.9 Proteus mirabilis HI4320 cysN sulfate adenylyltransferase subunit CysN
PMI_RS13790 PMI_RS13790 88.9 Proteus mirabilis HI4320 tuf elongation factor Tu
PMI_RS16130 PMI_RS16130 88.9 Proteus mirabilis HI4320 tuf elongation factor Tu

Distribution of the homologs in the orthogroup group_154

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_154

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q0SZX8 2.99e-22 89 95 0 45 3 tuf1 Elongation factor Tu 1 Shigella flexneri serotype 5b (strain 8401)
Q83JC4 3.11e-22 89 95 0 45 3 tufA Elongation factor Tu Shigella flexneri
Q32B27 3.11e-22 89 95 0 45 3 tuf1 Elongation factor Tu Shigella dysenteriae serotype 1 (strain Sd197)
Q31VV0 3.11e-22 89 95 0 45 3 tuf1 Elongation factor Tu Shigella boydii serotype 4 (strain Sb227)
P0A1H5 3.11e-22 89 95 0 45 3 tufA Elongation factor Tu Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1H6 3.11e-22 89 95 0 45 3 tufA Elongation factor Tu Salmonella typhi
A9MT05 3.11e-22 89 95 0 45 3 tuf1 Elongation factor Tu Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIW4 3.11e-22 89 95 0 45 3 tuf1 Elongation factor Tu Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57H76 3.11e-22 89 95 0 45 3 tuf1 Elongation factor Tu Salmonella choleraesuis (strain SC-B67)
A9MHG0 3.11e-22 89 95 0 45 3 tuf1 Elongation factor Tu Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q3YWT3 3.11e-22 89 95 0 45 3 tuf1 Elongation factor Tu 1 Shigella sonnei (strain Ss046)
Q1R5Y2 3.11e-22 89 95 0 45 1 tuf1 Elongation factor Tu 1 Escherichia coli (strain UTI89 / UPEC)
P0CE47 3.11e-22 89 95 0 45 1 tufA Elongation factor Tu 1 Escherichia coli (strain K12)
B1IPW0 3.11e-22 89 95 0 45 3 tuf1 Elongation factor Tu 1 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TCC0 3.11e-22 89 95 0 45 3 tuf1 Elongation factor Tu 1 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGM6 3.11e-22 89 95 0 45 3 tuf1 Elongation factor Tu 1 Escherichia coli O1:K1 / APEC
A8A5E6 3.11e-22 89 95 0 45 3 tuf1 Elongation factor Tu 1 Escherichia coli O9:H4 (strain HS)
A7ZSL4 3.11e-22 89 95 0 45 3 tuf1 Elongation factor Tu 1 Escherichia coli O139:H28 (strain E24377A / ETEC)
A6TEX7 3.24e-22 89 95 0 45 3 tufA Elongation factor Tu Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MKI5 3.24e-22 89 95 0 45 3 tuf1 Elongation factor Tu Cronobacter sakazakii (strain ATCC BAA-894)
A7ZUJ2 1.29e-21 87 93 0 45 3 tuf2 Elongation factor Tu 2 Escherichia coli O139:H28 (strain E24377A / ETEC)
P0A6N2 1.4e-21 87 93 0 45 3 tufA Elongation factor Tu Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A6N3 1.4e-21 87 93 0 45 3 tufA Elongation factor Tu Escherichia coli O157:H7
Q3YV04 1.4e-21 87 93 0 45 3 tuf2 Elongation factor Tu 2 Shigella sonnei (strain Ss046)
Q0SY20 1.4e-21 87 93 0 45 3 tuf2 Elongation factor Tu 2 Shigella flexneri serotype 5b (strain 8401)
Q1R5U4 1.4e-21 87 93 0 45 3 tuf2 Elongation factor Tu 2 Escherichia coli (strain UTI89 / UPEC)
P0CE48 1.4e-21 87 93 0 45 1 tufB Elongation factor Tu 2 Escherichia coli (strain K12)
B1IVA7 1.4e-21 87 93 0 45 3 tuf2 Elongation factor Tu 2 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TA85 1.4e-21 87 93 0 45 3 tuf2 Elongation factor Tu 2 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AIF3 1.4e-21 87 93 0 45 3 tuf2 Elongation factor Tu 2 Escherichia coli O1:K1 / APEC
A8A779 1.4e-21 87 93 0 45 3 tuf2 Elongation factor Tu 2 Escherichia coli O9:H4 (strain HS)
C4K4F8 2.13e-21 87 95 0 44 3 tuf Elongation factor Tu Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q6CZW6 2.43e-21 86 95 0 44 3 tuf1 Elongation factor Tu Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4W5A0 5.63e-21 85 91 0 45 3 tuf1 Elongation factor Tu Enterobacter sp. (strain 638)
Q664R7 8.18e-21 85 95 0 44 3 tuf2 Elongation factor Tu 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CCT9 8.18e-21 85 95 0 44 3 tuf2 Elongation factor Tu 2 Yersinia pestis bv. Antiqua (strain Nepal516)
A7FNN8 8.18e-21 85 95 0 44 3 tuf2 Elongation factor Tu 2 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TGY7 8.18e-21 85 95 0 44 3 tuf1 Elongation factor Tu 1 Yersinia pestis (strain Pestoides F)
Q8ZJB2 8.18e-21 85 95 0 44 3 tufA Elongation factor Tu-A Yersinia pestis
Q1C2U1 8.18e-21 85 95 0 44 3 tuf1 Elongation factor Tu 1 Yersinia pestis bv. Antiqua (strain Antiqua)
A1JS52 1.26e-20 84 93 0 44 3 tuf2 Elongation factor Tu 2 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GKK1 1.99e-20 84 90 0 44 3 tuf2 Elongation factor Tu 2 Serratia proteamaculans (strain 568)
Q12SW1 2.09e-20 84 88 0 45 3 tuf Elongation factor Tu Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q089Q6 2.31e-20 84 88 0 45 3 tuf2 Elongation factor Tu 2 Shewanella frigidimarina (strain NCIMB 400)
Q089R8 2.43e-20 84 88 0 45 3 tuf1 Elongation factor Tu 1 Shewanella frigidimarina (strain NCIMB 400)
A5EX84 5.38e-20 83 88 0 44 3 tuf Elongation factor Tu Dichelobacter nodosus (strain VCS1703A)
Q7TTF9 6.58e-20 82 88 0 44 3 tufA Elongation factor Tu Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0BQZ3 6.85e-20 82 88 0 44 3 tuf1 Elongation factor Tu Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N246 6.85e-20 82 88 0 44 3 tuf1 Elongation factor Tu Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A0KQ95 7.35e-20 82 93 0 44 3 tuf1 Elongation factor Tu Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A8G8E0 9.17e-20 82 90 0 44 3 tuf1 Elongation factor Tu 1 Serratia proteamaculans (strain 568)
B0UV21 1.2e-19 82 88 0 44 3 tuf Elongation factor Tu Histophilus somni (strain 2336)
Q0I1U9 1.2e-19 82 88 0 44 3 tuf1 Elongation factor Tu Histophilus somni (strain 129Pt)
Q65QG6 1.22e-19 82 88 0 44 3 tuf1 Elongation factor Tu Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P57939 1.22e-19 82 88 0 44 3 tufA Elongation factor Tu-A Pasteurella multocida (strain Pm70)
P57966 1.24e-19 82 88 0 44 3 tufB Elongation factor Tu-B Pasteurella multocida (strain Pm70)
O31298 1.37e-19 82 90 0 44 3 tuf Elongation factor Tu Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q4QMW6 1.69e-19 81 88 0 44 3 tuf1 Elongation factor Tu 1 Haemophilus influenzae (strain 86-028NP)
P43926 1.71e-19 81 88 0 44 3 tufA Elongation factor Tu Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHC1 1.71e-19 81 88 0 44 3 tuf Elongation factor Tu Haemophilus influenzae (strain PittGG)
A5U9R1 1.71e-19 81 88 0 44 3 tuf1 Elongation factor Tu Haemophilus influenzae (strain PittEE)
Q4QMT5 1.71e-19 81 88 0 44 3 tuf2 Elongation factor Tu 2 Haemophilus influenzae (strain 86-028NP)
A4XZ92 2.14e-19 81 88 0 44 3 tuf Elongation factor Tu Pseudomonas mendocina (strain ymp)
Q2NQL7 2.91e-19 81 90 0 44 3 tuf1 Elongation factor Tu Sodalis glossinidius (strain morsitans)
A6W394 3.19e-19 81 86 0 44 3 tuf Elongation factor Tu Marinomonas sp. (strain MWYL1)
A3Q980 3.28e-19 80 88 0 44 3 tuf2 Elongation factor Tu 2 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A3Q968 3.45e-19 80 88 0 44 3 tuf1 Elongation factor Tu 1 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
P09591 3.68e-19 80 88 0 44 1 tufA Elongation factor Tu Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T82 3.68e-19 80 88 0 44 1 tuf1 Elongation factor Tu Pseudomonas aeruginosa (strain UCBPP-PA14)
A6UZH4 3.68e-19 80 88 0 44 3 tuf1 Elongation factor Tu Pseudomonas aeruginosa (strain PA7)
A4VHM8 4.02e-19 80 86 0 44 3 tuf2 Elongation factor Tu 2 Stutzerimonas stutzeri (strain A1501)
P33169 4.18e-19 80 86 0 45 3 tuf Elongation factor Tu Shewanella putrefaciens
A4YBY5 4.18e-19 80 86 0 45 3 tuf1 Elongation factor Tu Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A4SHU2 4.18e-19 80 88 0 45 3 tuf1 Elongation factor Tu Aeromonas salmonicida (strain A449)
A4VHL6 4.23e-19 80 86 0 44 3 tuf1 Elongation factor Tu 1 Stutzerimonas stutzeri (strain A1501)
Q3BWY6 4.66e-19 80 84 0 44 3 tuf1 Elongation factor Tu Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8NL22 4.66e-19 80 84 0 44 3 tufA Elongation factor Tu Xanthomonas axonopodis pv. citri (strain 306)
Q0I0A7 4.66e-19 80 86 0 45 3 tuf2 Elongation factor Tu 2 Shewanella sp. (strain MR-7)
Q8EK70 4.66e-19 80 86 0 45 3 tuf2 Elongation factor Tu 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B0RU96 4.7e-19 80 84 0 44 3 tuf2 Elongation factor Tu 2 Xanthomonas campestris pv. campestris (strain B100)
Q4URC5 4.7e-19 80 84 0 44 3 tuf2 Elongation factor Tu 2 Xanthomonas campestris pv. campestris (strain 8004)
Q8PC59 4.7e-19 80 84 0 44 3 tufA Elongation factor Tu-A Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q0HNT9 4.76e-19 80 86 0 45 3 tuf2 Elongation factor Tu 2 Shewanella sp. (strain MR-4)
A6WHR4 4.85e-19 80 88 0 44 3 tuf1 Elongation factor Tu Shewanella baltica (strain OS185)
A9KWA0 4.85e-19 80 88 0 44 3 tuf2 Elongation factor Tu 2 Shewanella baltica (strain OS195)
A3DBA0 4.85e-19 80 88 0 44 3 tuf2 Elongation factor Tu 2 Shewanella baltica (strain OS155 / ATCC BAA-1091)
A9KW88 4.85e-19 80 88 0 44 3 tuf1 Elongation factor Tu 1 Shewanella baltica (strain OS195)
A3DA74 4.85e-19 80 88 0 44 3 tuf1 Elongation factor Tu 1 Shewanella baltica (strain OS155 / ATCC BAA-1091)
A1JIH3 5.21e-19 80 90 0 44 3 tuf1 Elongation factor Tu 1 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8PC51 5.3e-19 80 84 0 44 3 tufB Elongation factor Tu-B Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URD7 5.3e-19 80 84 0 44 3 tuf1 Elongation factor Tu 1 Xanthomonas campestris pv. campestris (strain 8004)
A1S204 5.31e-19 80 90 0 43 3 tuf1 Elongation factor Tu Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B0TX03 5.58e-19 80 86 0 44 3 tuf Elongation factor Tu Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B0RU84 5.63e-19 80 84 0 44 3 tuf1 Elongation factor Tu 1 Xanthomonas campestris pv. campestris (strain B100)
P59506 5.64e-19 80 81 0 44 3 tuf Elongation factor Tu Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q2W2H3 6.41e-19 80 88 0 44 3 tuf1 Elongation factor Tu Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A6VKH7 6.62e-19 80 86 0 44 3 tuf1 Elongation factor Tu Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A4IW92 9.69e-19 79 84 0 44 3 tuf Elongation factor Tu Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BKB8 9.69e-19 79 84 0 44 3 tuf Elongation factor Tu Francisella tularensis subsp. holarctica (strain OSU18)
A0Q874 9.69e-19 79 84 0 44 3 tuf Elongation factor Tu Francisella tularensis subsp. novicida (strain U112)
B2SFC9 9.69e-19 79 84 0 44 3 tuf Elongation factor Tu Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A1M0 9.69e-19 79 84 0 44 3 tuf Elongation factor Tu Francisella tularensis subsp. holarctica (strain LVS)
A7NEC7 9.69e-19 79 84 0 44 3 tuf Elongation factor Tu Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q5NID9 1.02e-18 79 84 0 44 3 tuf Elongation factor Tu Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JU2 1.02e-18 79 84 0 44 3 tuf Elongation factor Tu Francisella tularensis subsp. tularensis (strain FSC 198)
Q7VRP0 1.28e-18 79 84 0 45 3 tuf Elongation factor Tu Blochmanniella floridana
B8D851 1.4e-18 79 88 0 44 3 tuf Elongation factor Tu Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
O31297 1.4e-18 79 88 0 44 3 tuf Elongation factor Tu Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9U9 1.4e-18 79 88 0 44 3 tuf Elongation factor Tu Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A1TYJ5 1.74e-18 79 86 0 44 3 tuf Elongation factor Tu Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A0KRL0 1.77e-18 79 86 0 45 3 tuf1 Elongation factor Tu Shewanella sp. (strain ANA-3)
Q0I0B9 1.8e-18 79 86 0 45 3 tuf1 Elongation factor Tu 1 Shewanella sp. (strain MR-7)
Q0HNV1 1.8e-18 79 86 0 45 3 tuf1 Elongation factor Tu 1 Shewanella sp. (strain MR-4)
Q8EK81 2.03e-18 79 86 0 45 3 tuf1 Elongation factor Tu 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q057A2 2.07e-18 79 84 0 45 3 tuf Elongation factor Tu Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q5GWR8 2.33e-18 78 81 0 44 3 tuf1 Elongation factor Tu Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NZX1 2.33e-18 78 81 0 44 3 tuf1 Elongation factor Tu Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A4TS36 2.58e-18 78 86 0 44 3 tuf2 Elongation factor Tu 2 Yersinia pestis (strain Pestoides F)
Q8ZAN8 2.58e-18 78 86 0 44 3 tufB Elongation factor Tu-B Yersinia pestis
Q1C1T4 2.58e-18 78 86 0 44 3 tuf2 Elongation factor Tu 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q66FQ9 2.58e-18 78 86 0 44 3 tuf1 Elongation factor Tu 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FNJ0 2.58e-18 78 86 0 44 3 tuf1 Elongation factor Tu 1 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1CN86 2.66e-18 78 86 0 44 3 tuf1 Elongation factor Tu 1 Yersinia pestis bv. Antiqua (strain Nepal516)
Q1R0H7 2.66e-18 78 84 0 44 3 tuf Elongation factor Tu Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q6FF97 2.82e-18 78 88 0 43 3 tuf1 Elongation factor Tu Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A3M1F6 2.99e-18 78 88 0 43 3 tuf1 Elongation factor Tu Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B7H1K5 2.99e-18 78 88 0 43 3 tuf Elongation factor Tu Acinetobacter baumannii (strain AB307-0294)
C3K2X8 4.09e-18 77 86 0 44 3 tuf Elongation factor Tu Pseudomonas fluorescens (strain SBW25)
Q9KV37 4.3e-18 77 84 0 44 3 tufA Elongation factor Tu-A Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7MH43 4.43e-18 77 84 0 44 3 tuf1 Elongation factor Tu 1 Vibrio vulnificus (strain YJ016)
A5F3K0 4.52e-18 77 84 0 44 3 tuf1 Elongation factor Tu Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KUZ6 4.52e-18 77 84 0 44 3 tufB Elongation factor Tu-B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7MYE8 4.52e-18 77 88 0 44 3 tuf2 Elongation factor Tu 2 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N9B1 4.56e-18 77 88 0 44 3 tuf1 Elongation factor Tu 1 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7MGR1 4.61e-18 77 84 0 44 3 tuf2 Elongation factor Tu 2 Vibrio vulnificus (strain YJ016)
Q8DD27 4.61e-18 77 84 0 44 3 tuf1 Elongation factor Tu 1 Vibrio vulnificus (strain CMCP6)
Q8DCQ7 4.75e-18 77 84 0 44 3 tuf2 Elongation factor Tu 2 Vibrio vulnificus (strain CMCP6)
Q889X3 5.25e-18 77 82 0 45 3 tuf Elongation factor Tu Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48D34 5.8e-18 77 82 0 45 3 tuf Elongation factor Tu Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZMP2 5.86e-18 77 82 0 45 3 tuf Elongation factor Tu Pseudomonas syringae pv. syringae (strain B728a)
Q877T5 6.03e-18 77 84 0 44 3 tufA Elongation factor Tu Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q47UU9 6.03e-18 77 79 0 44 3 tuf1 Elongation factor Tu Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q6LLV5 6.03e-18 77 86 0 44 3 tuf2 Elongation factor Tu 2 Photobacterium profundum (strain SS9)
Q492B2 6.15e-18 77 80 0 45 3 tuf Elongation factor Tu Blochmanniella pennsylvanica (strain BPEN)
Q8D240 7.29e-18 77 79 0 44 3 tuf Elongation factor Tu Wigglesworthia glossinidia brevipalpis
Q3IJV1 8.14e-18 77 82 0 45 3 tuf2 Elongation factor Tu 2 Pseudoalteromonas translucida (strain TAC 125)
Q3ILP4 8.55e-18 77 82 0 45 3 tuf1 Elongation factor Tu 1 Pseudoalteromonas translucida (strain TAC 125)
C5BQ44 8.55e-18 77 84 0 44 3 tuf Elongation factor Tu Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q0ABH7 1.07e-17 76 79 0 44 3 tuf1 Elongation factor Tu Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A1WVD6 1.14e-17 76 81 0 44 3 tuf2 Elongation factor Tu 2 Halorhodospira halophila (strain DSM 244 / SL1)
A5WGK9 1.2e-17 76 86 0 43 3 tuf1 Elongation factor Tu 1 Psychrobacter sp. (strain PRwf-1)
Q21M86 1.24e-17 76 81 0 44 3 tuf1 Elongation factor Tu Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q5QWA3 1.25e-17 76 81 0 44 3 tuf1 Elongation factor Tu Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A5WH42 1.28e-17 76 86 0 43 3 tuf2 Elongation factor Tu 2 Psychrobacter sp. (strain PRwf-1)
Q15NP2 1.38e-17 76 81 0 44 3 tuf1 Elongation factor Tu Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q1Q8P2 1.55e-17 76 84 0 44 3 tuf1 Elongation factor Tu Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4K519 1.65e-17 76 86 0 44 3 tuf1 Elongation factor Tu Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A1WVC4 1.73e-17 76 81 0 44 3 tuf1 Elongation factor Tu 1 Halorhodospira halophila (strain DSM 244 / SL1)
A1AVJ8 2.47e-17 75 83 0 43 3 tuf1 Elongation factor Tu 1 Ruthia magnifica subsp. Calyptogena magnifica
A1AX82 2.57e-17 75 83 0 43 3 tuf2 Elongation factor Tu 2 Ruthia magnifica subsp. Calyptogena magnifica
Q3K5X4 2.71e-17 75 84 0 44 3 tuf1 Elongation factor Tu Pseudomonas fluorescens (strain Pf0-1)
B1JDW6 2.77e-17 75 84 0 44 3 tuf1 Elongation factor Tu Pseudomonas putida (strain W619)
B0KK53 2.77e-17 75 84 0 44 3 tuf1 Elongation factor Tu Pseudomonas putida (strain GB-1)
A5VXN3 2.77e-17 75 84 0 44 3 tuf Elongation factor Tu Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88QP8 2.77e-17 75 84 0 44 1 tufA Elongation factor Tu-A Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2S8Z8 2.91e-17 75 81 0 44 3 tuf1 Elongation factor Tu Hahella chejuensis (strain KCTC 2396)
Q4FQG6 2.96e-17 75 86 0 43 3 tuf1 Elongation factor Tu Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A7MXE4 2.97e-17 75 84 0 44 3 tuf1 Elongation factor Tu Vibrio campbellii (strain ATCC BAA-1116)
Q1IFW8 3.06e-17 75 84 0 44 3 tuf1 Elongation factor Tu Pseudomonas entomophila (strain L48)
Q88QN7 3.06e-17 75 84 0 44 3 tufB Elongation factor Tu-B Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q31IY4 3.4e-17 75 79 0 44 3 tuf1 Elongation factor Tu Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A8G1F0 3.45e-17 75 81 0 44 3 tuf Elongation factor Tu Shewanella sediminis (strain HAW-EB3)
A8GYW2 3.48e-17 75 80 0 45 3 tuf1 Elongation factor Tu Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TM14 3.52e-17 75 80 0 45 3 tuf1 Elongation factor Tu Shewanella halifaxensis (strain HAW-EB4)
A5CW32 3.91e-17 75 83 0 43 3 tuf1 Elongation factor Tu Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q3J8Q0 4.15e-17 75 79 0 44 3 tuf1 Elongation factor Tu Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q3SLQ1 4.58e-17 75 81 0 43 3 tuf1 Elongation factor Tu Thiobacillus denitrificans (strain ATCC 25259)
Q6LVC0 4.79e-17 75 84 0 44 3 tuf1 Elongation factor Tu 1 Photobacterium profundum (strain SS9)
Q81ZS3 5.06e-17 75 84 0 44 3 tuf1 Elongation factor Tu Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A7HWP7 5.32e-17 74 81 0 44 3 tuf1 Elongation factor Tu Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
P33168 5.34e-17 74 81 0 44 3 tuf Elongation factor Tu Deinonema sp.
Q1LSY4 5.67e-17 74 81 0 44 3 tuf Elongation factor Tu Baumannia cicadellinicola subsp. Homalodisca coagulata
Q0VSL7 7.24e-17 74 83 0 43 3 tuf1 Elongation factor Tu Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q0BUQ2 7.38e-17 74 83 0 43 3 tuf Elongation factor Tu Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q28UW7 8.21e-17 74 81 0 44 3 tuf1 Elongation factor Tu Jannaschia sp. (strain CCS1)
Q5WZL4 8.49e-17 74 77 0 44 3 tuf1 Elongation factor Tu Legionella pneumophila (strain Lens)
Q5ZYP5 9.01e-17 74 77 0 44 3 tuf1 Elongation factor Tu Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHR6 9.01e-17 74 77 0 44 3 tuf1 Elongation factor Tu Legionella pneumophila (strain Corby)
Q5X873 9.01e-17 74 77 0 44 3 tuf1 Elongation factor Tu Legionella pneumophila (strain Paris)
Q21RV6 1.09e-16 73 79 0 44 3 tuf2 Elongation factor Tu 2 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q13TF5 1.12e-16 73 77 0 44 3 tuf1 Elongation factor Tu Paraburkholderia xenovorans (strain LB400)
Q1GDV0 1.13e-16 73 79 0 44 3 tuf1 Elongation factor Tu Ruegeria sp. (strain TM1040)
A1WHC3 1.34e-16 73 77 0 44 3 tuf1 Elongation factor Tu Verminephrobacter eiseniae (strain EF01-2)
P17245 1.41e-16 73 72 0 44 3 tufA Elongation factor Tu, cyanelle Cyanophora paradoxa
A1VIP8 1.42e-16 73 77 0 44 3 tuf1 Elongation factor Tu Polaromonas naphthalenivorans (strain CJ2)
A1T056 1.46e-16 73 77 0 44 3 tuf Elongation factor Tu Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A2SLF9 1.57e-16 73 77 0 44 3 tuf1 Elongation factor Tu Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q21SF0 1.65e-16 73 77 0 44 3 tuf1 Elongation factor Tu 1 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q4JT41 1.79e-16 73 79 0 43 3 tuf Elongation factor Tu Corynebacterium jeikeium (strain K411)
Q47JA5 1.93e-16 73 79 0 44 3 tuf1 Elongation factor Tu Dechloromonas aromatica (strain RCB)
A1TJ05 2.07e-16 73 77 0 44 3 tuf1 Elongation factor Tu Paracidovorax citrulli (strain AAC00-1)
A1WCN6 2.09e-16 73 77 0 44 3 tuf2 Elongation factor Tu 2 Acidovorax sp. (strain JS42)
A1W2Q5 2.14e-16 73 77 0 44 3 tuf1 Elongation factor Tu 1 Acidovorax sp. (strain JS42)
Q605B0 2.16e-16 73 77 0 44 3 tuf1 Elongation factor Tu Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
C4LL63 2.2e-16 73 79 0 43 3 tuf Elongation factor Tu Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
Q83ES6 2.29e-16 73 75 0 44 1 tufA Elongation factor Tu Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAK7 2.29e-16 73 75 0 44 3 tuf1 Elongation factor Tu Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD33 2.29e-16 73 75 0 44 3 tuf1 Elongation factor Tu Coxiella burnetii (strain Dugway 5J108-111)
Q0AF46 2.31e-16 73 84 0 44 3 tuf2 Elongation factor Tu 2 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
P50064 2.33e-16 73 77 0 44 3 tufA Elongation factor Tu Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A7I3U7 2.37e-16 73 71 0 45 3 tuf Elongation factor Tu Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
B0SSH9 2.48e-16 73 72 0 44 3 tuf Elongation factor Tu Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SAF6 2.48e-16 73 72 0 44 3 tuf Elongation factor Tu Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q2RQU6 2.53e-16 72 81 0 44 3 tuf2 Elongation factor Tu 2 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q9P9Q9 2.55e-16 72 75 0 45 1 tufA Elongation factor Tu Xylella fastidiosa (strain 9a5c)
Q2RQV8 2.58e-16 72 81 0 44 3 tuf1 Elongation factor Tu 1 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
C0ZVT7 2.63e-16 72 77 0 44 3 tuf Elongation factor Tu Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q877P8 2.66e-16 72 75 0 45 3 tufA Elongation factor Tu Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q30X13 2.66e-16 72 75 0 44 3 tuf Elongation factor Tu Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A6T3K6 2.9e-16 72 77 0 44 3 tuf1 Elongation factor Tu Janthinobacterium sp. (strain Marseille)
P33167 2.93e-16 72 77 0 44 3 tuf Elongation factor Tu Burkholderia cepacia
B4RYQ8 3.07e-16 72 77 0 44 3 tuf Elongation factor Tu Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A4G9U0 3.08e-16 72 77 0 44 3 tuf1 Elongation factor Tu Herminiimonas arsenicoxydans
Q9R342 3.17e-16 72 77 0 44 3 tufA Elongation factor Tu Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q2YAZ9 3.17e-16 72 77 0 44 3 tuf1 Elongation factor Tu Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q0K5Z9 3.24e-16 72 77 0 44 3 tuf1 Elongation factor Tu Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1H4Q1 3.27e-16 72 77 0 44 3 tuf1 Elongation factor Tu 1 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q1H4N9 3.3e-16 72 77 0 44 3 tuf2 Elongation factor Tu 2 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q46WC7 3.34e-16 72 77 0 44 3 tuf1 Elongation factor Tu Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A8LLG2 3.36e-16 72 79 0 44 3 tuf1 Elongation factor Tu Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q1LI13 3.37e-16 72 77 0 44 3 tuf1 Elongation factor Tu Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A4SUU7 3.87e-16 72 75 0 45 3 tuf1 Elongation factor Tu Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q0C1F4 3.87e-16 72 79 0 43 3 tuf1 Elongation factor Tu 1 Hyphomonas neptunium (strain ATCC 15444)
Q0BYB2 4.03e-16 72 79 0 43 3 tuf2 Elongation factor Tu 2 Hyphomonas neptunium (strain ATCC 15444)
Q2LQA3 4.04e-16 72 79 0 44 3 tuf Elongation factor Tu Syntrophus aciditrophicus (strain SB)
Q2SU25 4.23e-16 72 77 0 44 3 tuf1 Elongation factor Tu Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63PZ6 4.23e-16 72 77 0 44 3 tuf1 Elongation factor Tu Burkholderia pseudomallei (strain K96243)
A3NEI1 4.23e-16 72 77 0 44 3 tuf1 Elongation factor Tu Burkholderia pseudomallei (strain 668)
Q3JMP6 4.23e-16 72 77 0 44 3 tuf1 Elongation factor Tu Burkholderia pseudomallei (strain 1710b)
A3P0B5 4.23e-16 72 77 0 44 3 tuf1 Elongation factor Tu Burkholderia pseudomallei (strain 1106a)
A1V8A5 4.23e-16 72 77 0 44 3 tuf1 Elongation factor Tu Burkholderia mallei (strain SAVP1)
Q62GK3 4.23e-16 72 77 0 44 3 tuf1 Elongation factor Tu Burkholderia mallei (strain ATCC 23344)
A2S7F9 4.23e-16 72 77 0 44 3 tuf1 Elongation factor Tu Burkholderia mallei (strain NCTC 10229)
A3MRT8 4.23e-16 72 77 0 44 3 tuf1 Elongation factor Tu Burkholderia mallei (strain NCTC 10247)
A9H3R7 4.36e-16 72 83 0 43 3 tuf Elongation factor Tu Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
P42481 4.4e-16 72 77 0 44 3 tuf Elongation factor Tu Thiomonas delicata
Q7M7F1 4.4e-16 72 75 0 45 3 tuf1 Elongation factor Tu Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A4JAM5 4.49e-16 72 77 0 44 3 tuf1 Elongation factor Tu Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q8XGZ0 4.67e-16 72 77 0 44 3 tufA Elongation factor Tu Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q1BRT3 4.72e-16 72 77 0 44 3 tuf1 Elongation factor Tu Burkholderia orbicola (strain AU 1054)
Q39KI2 4.72e-16 72 77 0 44 3 tuf1 Elongation factor Tu Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BJ48 4.72e-16 72 77 0 44 3 tuf1 Elongation factor Tu Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A0K3L0 4.72e-16 72 77 0 44 3 tuf1 Elongation factor Tu Burkholderia cenocepacia (strain HI2424)
A6MW28 4.79e-16 72 75 0 44 3 tufA Elongation factor Tu, chloroplastic Rhodomonas salina
Q2L2G6 4.81e-16 72 75 0 44 3 tuf1 Elongation factor Tu Bordetella avium (strain 197N)
Q2JFH8 5.54e-16 72 77 0 44 3 tuf Elongation factor Tu Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
A1KB29 5.64e-16 72 77 0 44 3 tuf1 Elongation factor Tu Azoarcus sp. (strain BH72)
P19457 5.71e-16 72 75 0 44 3 tufA Elongation factor Tu, chloroplastic Guillardia theta
Q8R603 5.84e-16 72 76 0 43 3 tuf Elongation factor Tu Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B1VET1 5.87e-16 72 76 0 43 3 tuf Elongation factor Tu Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q7TT91 5.87e-16 72 75 0 44 3 tuf1 Elongation factor Tu Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q79GC6 5.87e-16 72 75 0 44 3 tuf1 Elongation factor Tu Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q79G84 5.87e-16 72 75 0 44 3 tuf1 Elongation factor Tu Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q1IX70 6.09e-16 72 77 0 44 3 tuf1 Elongation factor Tu Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q123F6 6.16e-16 72 75 0 44 3 tuf1 Elongation factor Tu Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q6NJD5 7.22e-16 71 75 0 44 3 tuf Elongation factor Tu Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q5LMR5 7.43e-16 71 77 0 44 3 tuf1 Elongation factor Tu Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A1SNN5 7.53e-16 71 79 0 43 3 tuf Elongation factor Tu Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q0RRS3 7.53e-16 71 77 0 44 3 tuf Elongation factor Tu Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
P42439 7.66e-16 71 75 0 44 3 tuf Elongation factor Tu Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QBH0 7.97e-16 71 75 0 44 3 tuf Elongation factor Tu Corynebacterium glutamicum (strain R)
Q0AIJ7 8.05e-16 71 81 0 44 3 tuf1 Elongation factor Tu 1 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q9TLV8 8.17e-16 71 70 0 44 3 tufA Elongation factor Tu, chloroplastic Cyanidium caldarium
Q8FS84 8.89e-16 71 75 0 44 3 tuf Elongation factor Tu Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A0L5V8 9.25e-16 71 81 0 44 3 tuf1 Elongation factor Tu Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q2G8Y2 9.34e-16 71 76 0 43 3 tuf Elongation factor Tu Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A4FPM7 9.83e-16 71 79 0 43 3 tuf Elongation factor Tu Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A0RQJ3 9.97e-16 71 68 0 45 3 tuf Elongation factor Tu Campylobacter fetus subsp. fetus (strain 82-40)
A8MLC4 1e-15 71 72 0 44 3 tuf1 Elongation factor Tu Alkaliphilus oremlandii (strain OhILAs)
A6Q6H4 1.08e-15 71 73 0 45 3 tuf Elongation factor Tu Sulfurovum sp. (strain NBC37-1)
O31301 1.15e-15 70 94 0 35 3 tuf Elongation factor Tu (Fragment) Buchnera aphidicola subsp. Schlechtendalia chinensis
C1AYS3 1.31e-15 70 76 0 43 3 tuf Elongation factor Tu Rhodococcus opacus (strain B4)
Q0SFF4 1.31e-15 70 76 0 43 3 tuf Elongation factor Tu Rhodococcus jostii (strain RHA1)
Q1GP97 1.34e-15 70 81 0 43 3 tuf Elongation factor Tu Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B0T2B5 1.37e-15 70 77 0 44 3 tuf2 Elongation factor Tu 2 Caulobacter sp. (strain K31)
Q5FTY1 1.4e-15 70 79 0 43 3 tuf Elongation factor Tu Gluconobacter oxydans (strain 621H)
C3PKP2 1.4e-15 70 72 0 44 3 tuf Elongation factor Tu Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
B0SUQ7 1.42e-15 70 77 0 44 3 tuf1 Elongation factor Tu 1 Caulobacter sp. (strain K31)
Q30TQ5 1.42e-15 70 71 0 45 3 tuf Elongation factor Tu Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B0CCD0 1.45e-15 70 75 0 44 3 tuf Elongation factor Tu Acaryochloris marina (strain MBIC 11017)
Q5P334 1.55e-15 70 75 0 44 3 tuf1 Elongation factor Tu Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q85FT7 1.6e-15 70 72 0 44 3 tufA Elongation factor Tu, chloroplastic Cyanidioschyzon merolae (strain NIES-3377 / 10D)
P30768 1.66e-15 70 75 0 44 3 tuf Elongation factor Tu Mycobacterium leprae (strain TN)
B8ZSC1 1.66e-15 70 75 0 44 3 tuf Elongation factor Tu Mycobacterium leprae (strain Br4923)
A5GAW4 1.71e-15 70 75 0 44 3 tuf1 Elongation factor Tu Geotalea uraniireducens (strain Rf4)
B7JUP5 1.71e-15 70 72 0 44 3 tuf Elongation factor Tu Rippkaea orientalis (strain PCC 8801 / RF-1)
A1ALS6 1.76e-15 70 75 0 44 3 tuf1 Elongation factor Tu Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
P74227 1.88e-15 70 72 0 44 1 tuf Elongation factor Tu Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q39Y08 1.98e-15 70 75 0 44 3 tuf1 Elongation factor Tu Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A8LC58 2.04e-15 70 77 0 44 3 tuf Elongation factor Tu Parafrankia sp. (strain EAN1pec)
B9L7I8 2.05e-15 70 72 0 44 3 tuf Elongation factor Tu Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
O31300 2.13e-15 70 91 0 35 3 tuf Elongation factor Tu (Fragment) Buchnera aphidicola subsp. Melaphis rhois
A9BHA7 2.2e-15 70 70 0 44 3 tuf Elongation factor Tu Petrotoga mobilis (strain DSM 10674 / SJ95)
Q2JMX7 2.25e-15 70 72 0 44 3 tuf Elongation factor Tu Synechococcus sp. (strain JA-2-3B'a(2-13))
A0PM42 2.27e-15 70 75 0 44 3 tuf Elongation factor Tu Mycobacterium ulcerans (strain Agy99)
B2HSL3 2.27e-15 70 75 0 44 3 tuf Elongation factor Tu Mycobacterium marinum (strain ATCC BAA-535 / M)
Q0P3M7 2.32e-15 70 70 0 44 3 tufA Elongation factor Tu, chloroplastic Ostreococcus tauri
A1B002 2.49e-15 70 75 0 44 3 tuf1 Elongation factor Tu Paracoccus denitrificans (strain Pd 1222)
A6LPP6 2.52e-15 70 77 0 44 3 tuf1 Elongation factor Tu Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q2N9A8 2.59e-15 70 76 0 43 3 tuf Elongation factor Tu Erythrobacter litoralis (strain HTCC2594)
P72231 2.62e-15 70 72 0 44 3 tuf Elongation factor Tu Planobispora rosea
A0LRL8 2.64e-15 70 75 0 44 3 tuf Elongation factor Tu Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q8DI42 2.8e-15 70 72 0 44 3 tuf Elongation factor Tu Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q748X8 2.8e-15 70 72 0 44 3 tuf1 Elongation factor Tu Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
O66429 2.95e-15 70 70 0 44 3 tufA Elongation factor Tu Aquifex aeolicus (strain VF5)
Q9MUP0 3.06e-15 70 68 0 44 3 tufA Elongation factor Tu, chloroplastic Mesostigma viride
Q7VJ74 3.07e-15 70 70 0 44 3 tuf Elongation factor Tu Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q7UMZ0 3.1e-15 70 72 0 44 3 tuf Elongation factor Tu Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
O50293 3.13e-15 70 70 0 44 3 tuf Elongation factor Tu Aquifex pyrophilus
C1A6Q3 3.17e-15 69 71 0 45 3 tuf Elongation factor Tu Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
B7K834 3.19e-15 70 72 0 44 3 tuf Elongation factor Tu Gloeothece citriformis (strain PCC 7424)
Q839G8 3.24e-15 69 70 0 44 3 tuf Elongation factor Tu Enterococcus faecalis (strain ATCC 700802 / V583)
Q6A6L7 3.28e-15 69 72 0 44 3 tuf Elongation factor Tu Cutibacterium acnes (strain DSM 16379 / KPA171202)
A7ZCN0 3.46e-15 69 66 0 45 3 tuf Elongation factor Tu Campylobacter concisus (strain 13826)
A5FZW7 3.51e-15 69 76 0 43 3 tuf Elongation factor Tu Acidiphilium cryptum (strain JF-5)
Q0ANN1 3.65e-15 69 77 0 44 3 tuf1 Elongation factor Tu Maricaulis maris (strain MCS10)
B1WQY4 3.8e-15 69 72 0 44 3 tuf Elongation factor Tu Crocosphaera subtropica (strain ATCC 51142 / BH68)
O21245 3.83e-15 69 68 0 44 3 TUFA Elongation factor Tu, mitochondrial Reclinomonas americana
Q5YPG4 3.95e-15 69 72 0 44 3 tuf Elongation factor Tu Nocardia farcinica (strain IFM 10152)
Q2JUX4 4.23e-15 69 70 0 44 3 tuf Elongation factor Tu Synechococcus sp. (strain JA-3-3Ab)
Q72GW4 4.39e-15 69 70 0 44 3 tuf1 Elongation factor Tu Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q01698 4.39e-15 69 70 0 44 1 tuf Elongation factor Tu Thermus aquaticus
Q20EU5 4.5e-15 69 68 0 45 3 tufA Elongation factor Tu, chloroplastic Oltmannsiellopsis viridis
P60339 4.56e-15 69 70 0 44 1 tufB Elongation factor Tu-B Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q3J5S4 4.68e-15 69 73 0 45 3 tuf1 Elongation factor Tu Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGI1 4.68e-15 69 73 0 45 3 tuf1 Elongation factor Tu Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
P60338 4.7e-15 69 70 0 44 1 tufA Elongation factor Tu-A Thermus thermophilus
Q5SHN6 4.7e-15 69 70 0 44 1 tufA Elongation factor Tu-A Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
A4WVL0 4.73e-15 69 73 0 45 3 tuf1 Elongation factor Tu Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q9XD38 4.76e-15 69 72 0 43 3 tuf Elongation factor Tu Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72NF9 4.76e-15 69 72 0 43 3 tuf Elongation factor Tu Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
P56292 4.91e-15 69 75 0 44 3 tufA Elongation factor Tu, chloroplastic Chlorella vulgaris
Q4G342 5.35e-15 69 72 0 44 3 tufA Elongation factor Tu, chloroplastic Emiliania huxleyi
P9WNN1 6.11e-15 68 72 0 44 1 tuf Elongation factor Tu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNN0 6.11e-15 68 72 0 44 3 tuf Elongation factor Tu Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U071 6.11e-15 68 72 0 44 3 tuf Elongation factor Tu Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AL18 6.11e-15 68 72 0 44 3 tuf Elongation factor Tu Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KGG5 6.11e-15 68 72 0 44 3 tuf Elongation factor Tu Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A559 6.11e-15 68 72 0 44 3 tuf Elongation factor Tu Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8ETY4 6.16e-15 68 70 0 44 3 tuf Elongation factor Tu Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B1XI63 6.21e-15 68 70 0 44 3 tuf Elongation factor Tu Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A7NR65 6.27e-15 68 72 0 44 3 tuf1 Elongation factor Tu 1 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A5V604 6.35e-15 68 74 0 43 3 tuf Elongation factor Tu Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q118Z2 6.46e-15 68 70 0 44 3 tuf Elongation factor Tu Trichodesmium erythraeum (strain IMS101)
P49462 6.79e-15 68 68 0 44 3 tufA Elongation factor Tu, chloroplastic Trieres chinensis
Q3A6R2 6.9e-15 68 77 0 44 3 tuf1 Elongation factor Tu 1 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q6B8Y0 7.2e-15 68 72 0 44 3 tufA Elongation factor Tu, chloroplastic Gracilaria tenuistipitata var. liui
A6TWI4 7.45e-15 68 75 0 44 3 tuf1 Elongation factor Tu 1 Alkaliphilus metalliredigens (strain QYMF)
Q9TKZ5 7.5e-15 68 68 0 45 3 tufA Elongation factor Tu, chloroplastic Nephroselmis olivacea
B8HVR7 7.57e-15 68 72 0 44 3 tuf Elongation factor Tu Cyanothece sp. (strain PCC 7425 / ATCC 29141)
A6TWJ8 7.6e-15 68 75 0 44 3 tuf2 Elongation factor Tu 2 Alkaliphilus metalliredigens (strain QYMF)
Q82DQ0 7.6e-15 68 72 0 43 3 tuf1 Elongation factor Tu 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A4T1R2 7.66e-15 68 72 0 44 3 tuf Elongation factor Tu Mycolicibacterium gilvum (strain PYR-GCK)
A7NS01 7.95e-15 68 72 0 44 3 tuf2 Elongation factor Tu 2 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A1T4L6 7.97e-15 68 72 0 44 3 tuf Elongation factor Tu Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q73SD1 8.21e-15 68 72 0 44 3 tuf Elongation factor Tu Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QL35 8.21e-15 68 72 0 44 3 tuf Elongation factor Tu Mycobacterium avium (strain 104)
A0T100 8.27e-15 68 68 0 44 3 tufA Elongation factor Tu, chloroplastic Thalassiosira pseudonana
A0QS98 8.37e-15 68 72 0 44 1 tuf Elongation factor Tu Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q3B6G3 8.42e-15 68 76 0 43 3 tuf Elongation factor Tu Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
P18668 8.51e-15 68 70 0 44 3 tuf Elongation factor Tu Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P33171 8.51e-15 68 70 0 44 3 tuf Elongation factor Tu Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A8EW02 8.53e-15 68 70 0 44 3 tuf Elongation factor Tu Aliarcobacter butzleri (strain RM4018)
A2CI56 8.69e-15 68 72 0 44 3 tufA Elongation factor Tu, chloroplastic Chlorokybus atmophyticus
A6W5T5 8.81e-15 68 72 0 44 3 tuf Elongation factor Tu Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
A9KRZ4 8.9e-15 68 71 0 45 3 tuf Elongation factor Tu Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q6AP73 9.24e-15 68 72 0 44 3 tuf2 Elongation factor Tu 2 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B1MGH7 9.25e-15 68 72 0 44 3 tuf Elongation factor Tu Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
B9KFF9 9.28e-15 68 65 0 44 3 tuf Elongation factor Tu Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A1USC1 9.45e-15 68 72 0 44 3 tuf1 Elongation factor Tu 1 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A9ISD9 9.54e-15 68 72 0 44 3 tuf1 Elongation factor Tu Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q8KHX9 9.54e-15 68 72 0 44 3 tuf1 Elongation factor Tu Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A4SCQ7 9.57e-15 68 76 0 43 3 tuf Elongation factor Tu Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q2II78 9.61e-15 68 79 0 44 3 tuf1 Elongation factor Tu Anaeromyxobacter dehalogenans (strain 2CP-C)
A1USL2 9.83e-15 68 72 0 44 3 tuf2 Elongation factor Tu 2 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q6FZL2 1e-14 68 72 0 44 3 tuf2 Elongation factor Tu 2 Bartonella quintana (strain Toulouse)
Q6FZC0 1e-14 68 72 0 44 3 tuf1 Elongation factor Tu 1 Bartonella quintana (strain Toulouse)
A7HBL7 1.01e-14 68 79 0 44 3 tuf1 Elongation factor Tu Anaeromyxobacter sp. (strain Fw109-5)
Q2RFP5 1.04e-14 68 72 0 44 3 tuf Elongation factor Tu Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
P26184 1.05e-14 68 75 0 44 3 tuf Elongation factor Tu Flexistipes sinusarabici
A1KRF9 1.09e-14 68 71 0 45 3 tuf1 Elongation factor Tu Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P64027 1.09e-14 68 71 0 45 1 tufA Elongation factor Tu Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P64026 1.09e-14 68 71 0 45 3 tufA Elongation factor Tu Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q160Y4 1.1e-14 68 76 0 43 3 tuf1 Elongation factor Tu Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B0JSE0 1.11e-14 68 68 0 44 3 tuf Elongation factor Tu Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q5F5Q8 1.11e-14 68 71 0 45 3 tuf1 Elongation factor Tu Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q1BDD3 1.13e-14 68 74 0 43 3 tuf Elongation factor Tu Mycobacterium sp. (strain MCS)
A1UBL1 1.13e-14 68 74 0 43 3 tuf Elongation factor Tu Mycobacterium sp. (strain KMS)
A3PV96 1.13e-14 68 74 0 43 3 tuf Elongation factor Tu Mycobacterium sp. (strain JLS)
A4XBP8 1.17e-14 68 72 0 44 3 tuf Elongation factor Tu Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
P48864 1.18e-14 68 71 0 45 3 tuf Elongation factor Tu Neisseria gonorrhoeae
O50340 1.2e-14 68 63 0 44 3 tuf Elongation factor Tu Fervidobacterium islandicum
Q11HA6 1.26e-14 68 76 0 43 3 tuf1 Elongation factor Tu Chelativorans sp. (strain BNC1)
A6LLL1 1.26e-14 68 65 0 44 3 tuf Elongation factor Tu Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
P42471 1.28e-14 68 73 0 45 3 tuf Elongation factor Tu Brevibacterium linens
Q1AU14 1.31e-14 68 75 0 44 3 tuf1 Elongation factor Tu Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
P40174 1.33e-14 68 72 0 43 3 tuf1 Elongation factor Tu-1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A5USJ1 1.34e-14 68 72 0 44 3 tuf1 Elongation factor Tu 1 Roseiflexus sp. (strain RS-1)
Q47LJ1 1.36e-14 68 70 0 44 3 tuf Elongation factor Tu Thermobifida fusca (strain YX)
Q53871 1.39e-14 68 72 0 43 3 tuf1 Elongation factor Tu-1 Streptomyces collinus
Q0AUH8 1.39e-14 68 72 0 43 3 tuf1 Elongation factor Tu 1 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A6Q1L5 1.42e-14 68 70 0 44 3 tuf Elongation factor Tu Nitratiruptor sp. (strain SB155-2)
P95724 1.43e-14 68 72 0 43 3 tuf Elongation factor Tu Streptomyces cinnamoneus
Q01SX2 1.45e-14 68 70 0 44 3 tuf1 Elongation factor Tu Solibacter usitatus (strain Ellin6076)
Q0AUG3 1.46e-14 68 72 0 43 3 tuf2 Elongation factor Tu 2 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B3EH93 1.46e-14 68 75 0 44 3 tuf Elongation factor Tu Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A7HM54 1.48e-14 68 63 0 44 3 tuf Elongation factor Tu Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
B7IHU4 1.49e-14 68 65 0 44 3 tuf Elongation factor Tu Thermosipho africanus (strain TCF52B)
B1HMZ0 1.51e-14 68 70 0 44 3 tuf Elongation factor Tu Lysinibacillus sphaericus (strain C3-41)
P29542 1.55e-14 67 70 0 44 3 tuf1 Elongation factor Tu-1 Streptomyces ramocissimus
Q7V500 1.56e-14 67 70 0 44 3 tuf Elongation factor Tu Prochlorococcus marinus (strain MIT 9313)
A2CC87 1.56e-14 67 70 0 44 3 tuf Elongation factor Tu Prochlorococcus marinus (strain MIT 9303)
A9WSW5 1.59e-14 67 72 0 44 3 tuf Elongation factor Tu Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q5NQ65 1.59e-14 67 77 0 44 3 tuf Elongation factor Tu Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A5UYI1 1.6e-14 67 72 0 44 3 tuf2 Elongation factor Tu 2 Roseiflexus sp. (strain RS-1)
Q99QM0 1.61e-14 67 72 0 44 3 tufA Elongation factor Tu Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P64025 1.61e-14 67 72 0 44 3 tufA Elongation factor Tu Brucella suis biovar 1 (strain 1330)
A5VR08 1.61e-14 67 72 0 44 3 tuf1 Elongation factor Tu Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P64024 1.61e-14 67 72 0 44 3 tufA Elongation factor Tu Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M5Q2 1.61e-14 67 72 0 44 3 tuf1 Elongation factor Tu Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q2YM08 1.61e-14 67 72 0 44 3 tuf1 Elongation factor Tu Brucella abortus (strain 2308)
B0CH34 1.66e-14 67 72 0 44 3 tuf1 Elongation factor Tu Brucella suis (strain ATCC 23445 / NCTC 10510)
A6X0A2 1.71e-14 67 72 0 44 3 tuf1 Elongation factor Tu Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P42482 1.73e-14 67 72 0 43 3 tuf Elongation factor Tu Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A7GZK6 1.73e-14 67 64 0 45 3 tuf Elongation factor Tu Campylobacter curvus (strain 525.92)
P64029 1.77e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus aureus (strain MW2)
A8YZP5 1.77e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus aureus (strain USA300 / TCH1516)
Q6GBT9 1.77e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus aureus (strain MSSA476)
Q6GJC0 1.77e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus aureus (strain MRSA252)
P99152 1.77e-14 67 68 0 44 1 tuf Elongation factor Tu Staphylococcus aureus (strain N315)
P64028 1.77e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QEK0 1.77e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus aureus (strain Newman)
Q5HIC7 1.77e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus aureus (strain COL)
Q2YSB3 1.77e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IQA2 1.77e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus aureus (strain JH9)
Q2G0N0 1.77e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJ92 1.77e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus aureus (strain USA300)
A6TZ25 1.77e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus aureus (strain JH1)
A7WYX6 1.77e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q67JU1 1.77e-14 67 69 0 43 3 tuf Elongation factor Tu Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
O33594 1.79e-14 67 72 0 43 3 tuf1 Elongation factor Tu Kitasatospora aureofaciens
Q4L3K9 1.8e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus haemolyticus (strain JCSC1435)
C4ZB99 1.86e-14 67 68 0 44 3 tuf Elongation factor Tu Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
B8ELG5 1.86e-14 67 76 0 43 3 tuf Elongation factor Tu Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B9DKV8 1.88e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus carnosus (strain TM300)
Q134R0 1.9e-14 67 77 0 44 3 tuf2 Elongation factor Tu 2 Rhodopseudomonas palustris (strain BisB5)
Q8YP63 1.91e-14 67 70 0 44 1 tuf Elongation factor Tu Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q134S7 1.92e-14 67 77 0 44 3 tuf1 Elongation factor Tu 1 Rhodopseudomonas palustris (strain BisB5)
Q89J82 1.94e-14 67 77 0 44 3 tuf Elongation factor Tu Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8CQ81 1.97e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRK4 1.97e-14 67 68 0 44 3 tuf Elongation factor Tu Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q2IXR2 1.97e-14 67 77 0 44 3 tuf1 Elongation factor Tu Rhodopseudomonas palustris (strain HaA2)
Q3APH1 2.01e-14 67 74 0 43 3 tuf Elongation factor Tu Chlorobium chlorochromatii (strain CaD3)
Q07KJ2 2.01e-14 67 77 0 44 3 tuf1 Elongation factor Tu Rhodopseudomonas palustris (strain BisA53)
Q211E6 2.03e-14 67 77 0 44 3 tuf Elongation factor Tu Rhodopseudomonas palustris (strain BisB18)
B6JET1 2.03e-14 67 77 0 44 3 tuf Elongation factor Tu Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q3MDM5 2.06e-14 67 70 0 44 3 tuf Elongation factor Tu Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P42472 2.09e-14 67 70 0 44 3 tuf Elongation factor Tu (Fragment) Chloroflexus aurantiacus
A4YSJ0 2.16e-14 67 77 0 44 3 tuf Elongation factor Tu Bradyrhizobium sp. (strain ORS 278)
A5ELM9 2.16e-14 67 77 0 44 3 tuf Elongation factor Tu Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A9WFP3 2.21e-14 67 70 0 44 3 tuf1 Elongation factor Tu Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q3A6P9 2.27e-14 67 75 0 44 3 tuf2 Elongation factor Tu 2 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B8DLL9 2.36e-14 67 72 0 44 3 tuf Elongation factor Tu Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
C4Z2R9 2.55e-14 67 68 0 44 3 tuf Elongation factor Tu Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
Q7U4D1 2.61e-14 67 70 0 44 3 tuf Elongation factor Tu Parasynechococcus marenigrum (strain WH8102)
Q3SSW8 2.81e-14 67 75 0 44 3 tuf Elongation factor Tu Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q1MPT8 2.87e-14 67 72 0 44 3 tuf Elongation factor Tu Lawsonia intracellularis (strain PHE/MN1-00)
Q6N4Q4 2.93e-14 67 77 0 44 3 tuf1 Elongation factor Tu Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
C6C171 2.96e-14 67 72 0 44 3 tuf Elongation factor Tu Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q6MDN0 3.07e-14 67 65 0 44 3 tuf Elongation factor Tu Protochlamydia amoebophila (strain UWE25)
B9E8Q0 3.07e-14 67 75 0 41 3 tuf Elongation factor Tu Macrococcus caseolyticus (strain JCSC5402)
A4J0Z5 3.12e-14 67 80 0 41 3 tuf Elongation factor Tu Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A5GW14 3.31e-14 67 70 0 44 3 tuf Elongation factor Tu Synechococcus sp. (strain RCC307)
B8J1A0 3.4e-14 67 74 0 43 3 tuf Elongation factor Tu Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q1QN32 3.53e-14 67 75 0 44 3 tuf Elongation factor Tu Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q055E6 3.62e-14 67 68 0 44 3 tuf1 Elongation factor Tu Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04PT6 3.62e-14 67 68 0 44 3 tuf Elongation factor Tu Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
P13552 3.87e-14 67 72 0 44 3 tuf Elongation factor Tu Arthrospira platensis
A8M531 4.02e-14 66 70 0 44 3 tuf Elongation factor Tu Salinispora arenicola (strain CNS-205)
Q3AMT6 4.15e-14 66 68 0 44 3 tuf Elongation factor Tu Synechococcus sp. (strain CC9605)
C5CGR6 4.19e-14 66 65 0 44 3 tuf Elongation factor Tu Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
A6YG72 4.23e-14 66 72 0 44 3 tufA Elongation factor Tu, chloroplastic Pleurastrum terricola
P50373 4.27e-14 66 65 0 44 3 tufA Elongation factor Tu, chloroplastic Stephanocyclus meneghinianus
P14634 4.27e-14 66 68 0 44 3 tufA Elongation factor Tu, plastid Euglena longa
Q822I4 4.37e-14 66 61 0 44 3 tuf Elongation factor Tu Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q05FI3 4.39e-14 66 64 0 45 3 tuf Elongation factor Tu Carsonella ruddii (strain PV)
Q9Z9L6 4.52e-14 66 68 0 44 3 tuf Elongation factor Tu Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A8HTW6 4.61e-14 66 75 0 44 3 tuf1 Elongation factor Tu Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B3QY22 4.68e-14 66 70 0 44 3 tuf Elongation factor Tu Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q8KTA6 4.69e-14 66 72 0 43 3 tuf Elongation factor Tu Rickettsia parkeri

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_19970
Feature type CDS
Gene -
Product hypothetical protein
Location 3 - 140 (strand: -1)
Length 138 (nucleotides) / 45 (amino acids)
In genomic island -

Contig

Accession ZDB_619
Length 338 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_154
Orthogroup size 10
N. genomes 7

Actions

Genomic region

Domains

PF03143 Elongation factor Tu C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0050 Translation, ribosomal structure and biogenesis (J) J Translation elongation factor EF-Tu, a GTPase

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG046474 elongation factor Tu VF0460 Adherence

Protein Sequence

MVMPGDNIKMIVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVMG

Flanking regions ( +/- flanking 50bp)

TCCGTACCACAGACGTAACAGGTACTATCGAACTGCCGGAAGGCGTTGAAATGGTAATGCCGGGCGACAACATCAAAATGATCGTCACCCTGATCCACCCAATCGCAATGGACGATGGTCTGCGTTTCGCAATCCGTGAAGGCGGCCGTACCGTTGGCGCGGGTGTTGTAGCGAAAGTGATGGGTTAATT