Homologs in group_373

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18045 FBDBKF_18045 100.0 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
FBDBKF_19670 FBDBKF_19670 42.5 Morganella morganii S1 - XRE family transcriptional regulator
EHELCC_16745 EHELCC_16745 100.0 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_17625 LHKJJB_17625 100.0 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_17440 HKOGLL_17440 100.0 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
F4V73_RS10085 F4V73_RS10085 20.3 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
PMI_RS01380 PMI_RS01380 24.1 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_373

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_373

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0C5S2 1.13e-06 46 43 2 69 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 1.13e-06 46 43 2 69 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
Q8NTD8 1.39e-05 44 32 1 67 2 ramB HTH-type transcriptional regulator RamB Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P15017 3.01e-05 42 30 1 81 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
P55681 7.05e-05 42 31 1 69 4 NGR_a01020 Uncharacterized HTH-type transcriptional regulator y4wC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B8GI76 0.000446 40 35 1 67 3 Mpal_0031 Putative HTH-type transcriptional regulatory protein Mpal_0031 Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_17705
Feature type CDS
Gene hipB
Product Transcriptional regulator, contains XRE-family HTH domain
Location 44325 - 44594 (strand: 1)
Length 270 (nucleotides) / 89 (amino acids)
In genomic island -

Contig

Accession ZDB_537
Length 55765 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_373
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MKNNQILLHDVGALIRKLRKEKRMSGVDLGAELGISQQQISRYENATSEISVSTLINILAVFNITPAEFFTRISDTKHDFFSKYTTGNW

Flanking regions ( +/- flanking 50bp)

TAAACACATCACACCTGAATCCTGTTATGGCCCGGGGAGTGGAATCTATTATGAAAAATAATCAAATATTACTGCATGATGTAGGCGCACTGATCCGAAAGTTACGTAAAGAAAAAAGAATGAGCGGCGTTGATCTTGGCGCGGAACTGGGAATCAGCCAGCAACAGATCTCCCGCTATGAAAATGCCACGAGTGAAATATCAGTCTCAACACTCATTAATATACTTGCTGTATTTAATATAACACCCGCTGAATTTTTTACCCGTATCTCTGATACGAAACATGATTTTTTCAGCAAATACACCACCGGGAACTGGTAAATACCAGCCAATTAGTCCGTTAATTATTGTTGTTATGCATCAGGAAGATA