Homologs in group_373

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18045 FBDBKF_18045 42.5 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_16745 EHELCC_16745 42.5 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_17705 NLDBIP_17705 42.5 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_17625 LHKJJB_17625 42.5 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_17440 HKOGLL_17440 42.5 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
F4V73_RS10085 F4V73_RS10085 28.7 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
PMI_RS01380 PMI_RS01380 29.7 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_373

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_373

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q92HV3 7.19e-06 45 32 0 70 4 RC0668 Uncharacterized HTH-type transcriptional regulator RC0668 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9ZD50 9.61e-06 44 32 0 70 4 RP497 Uncharacterized HTH-type transcriptional regulator RP497 Rickettsia prowazekii (strain Madrid E)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_19670
Feature type CDS
Gene -
Product XRE family transcriptional regulator
Location 62 - 391 (strand: 1)
Length 330 (nucleotides) / 109 (amino acids)
In genomic island -

Contig

Accession contig_43
Length 19499 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_373
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MKMKINKKLYPIRYIENSGLTLQECVGILIRKIRIEKGLSGEELAFYVGLSQQQISRYERAESEMTLGQLQMFSEALGMSIWKFMDILRLLLDPEVYENKKSKQHLSSS

Flanking regions ( +/- flanking 50bp)

AAATAATTTAATTGTATTAAAGATAGTTATTCTATTCATAATGGTTTATAATGAAAATGAAGATAAATAAAAAATTATATCCAATAAGATATATTGAGAATTCAGGGCTGACACTGCAGGAGTGTGTCGGAATATTAATTCGTAAGATACGGATAGAAAAAGGATTGAGTGGTGAGGAATTAGCTTTTTATGTAGGACTAAGTCAACAGCAGATTTCACGTTACGAGCGGGCTGAAAGTGAAATGACACTGGGACAGTTACAGATGTTTTCAGAAGCGTTGGGAATGAGTATATGGAAATTTATGGATATATTACGGTTATTGTTAGATCCTGAAGTCTATGAAAATAAAAAAAGCAAACAACATTTATCATCATCATGAAGTAGTGTTTTTTTAATTACCAATAAATCCAGCATGTAATTAAATTACAG